AP4B1 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit AP4B1 Antibody - BSA Free (NBP2-87012) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of human AP4B1. Peptide sequence: GAERCDPELPKTSSFAASGPLIPEENKERVQELPDSGALMLVPNRQLTAD The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
AP4B1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for AP4B1 Antibody - BSA Free
Background
AP4B1, or AP-4 complex subunit beta-1, consists of a 739 amino acid isoform that is 83 kDa, and is involved in targeting specific proteins that move between the trans-Golgi network and the endosomal-lysosomal system. The AP4B1 protein is included in current research on a variety of diseases and disorders including cerebral palsy, neuronitis, malaria, spasticity, spastic paraplegia, hypotonia, intellectual disability, and cerebritis. The protein interacts with AP4E1, MY, AP4M1, BUB1, and BUB1B in several biological processes, such as membrane trafficking, Golgi associated vesicle biogenesis, and clathrin derived vesicle budding.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Ch, Gp, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu
Applications: ELISA, WB
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Publications for AP4B1 Antibody (NBP2-87012) (0)
There are no publications for AP4B1 Antibody (NBP2-87012).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for AP4B1 Antibody (NBP2-87012) (0)
There are no reviews for AP4B1 Antibody (NBP2-87012).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for AP4B1 Antibody (NBP2-87012) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional AP4B1 Products
Blogs on AP4B1