AP2S1 Antibody

Images

 
Western Blot: AP2S1 Antibody [NBP2-83937] - Host: Rabbit. Target Name: AP2S1. Sample Tissue: Human Hela Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AP2S1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle terminal region of human AP2S1. Peptide sequence: NFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQL The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
AP2S1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AP2S1 Antibody

  • Adapter-related protein complex 2 sigma subunit
  • Adaptor protein complex AP-2 subunit sigma
  • adaptor-related protein complex 2, sigma 1 subunit
  • AP17HA2 17 kDa subunit
  • AP-2 complex subunit sigma
  • CLAPS2AP17-DELTA
  • Clathrin assembly protein 2 small chain
  • Clathrin coat assembly protein AP17
  • Clathrin coat-associated protein AP17
  • clathrin-associated/assembly/adaptor protein, small 2 (17kD)
  • Plasma membrane adaptor AP-2 17 kDa protein
  • sigma2-adaptin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46862
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74359
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-89065
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67710
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP2-67861
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP3-06300
Species: Hu
Applications: WB, ICC/IF
NB100-1063
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-67762
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB8306
Species: Hu
Applications: WB, IHC
NBP2-92058
Species: Hu, Mu
Applications: WB
NBP2-97464
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-15563
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-57109
Species: Hu
Applications: WB, ICC/IF
NBP1-49643
Species: Hu, Mu, Bv, Pm
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-P, Flow-IC, KO
NBP2-83937
Species: Hu
Applications: WB

Publications for AP2S1 Antibody (NBP2-83937) (0)

There are no publications for AP2S1 Antibody (NBP2-83937).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AP2S1 Antibody (NBP2-83937) (0)

There are no reviews for AP2S1 Antibody (NBP2-83937). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AP2S1 Antibody (NBP2-83937) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional AP2S1 Products

Bioinformatics Tool for AP2S1 Antibody (NBP2-83937)

Discover related pathways, diseases and genes to AP2S1 Antibody (NBP2-83937). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AP2S1 Antibody (NBP2-83937)

Discover more about diseases related to AP2S1 Antibody (NBP2-83937).
 

Pathways for AP2S1 Antibody (NBP2-83937)

View related products by pathway.

Blogs on AP2S1

There are no specific blogs for AP2S1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AP2S1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AP2S1