AP1S1 Antibody

Images

 
Western Blot: AP1S1 Antibody [NBP2-84437] - Host: Rabbit. Target Name: Ap1s1. Sample Type: Mouse Heart lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AP1S1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse AP1S1. Peptide sequence: VCELDIIFNFEKAYFILDEFLMGGDVQDTSKKSVLKAIEQADLLQEEDES The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
AP1S1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AP1S1 Antibody

  • adaptor-related protein complex 1, sigma 1 subunit
  • AP19HA1 19 kDa subunit
  • CLAPS1FLJ92436
  • Clathrin assembly protein complex 1 sigma-1A small chain
  • Clathrin coat assembly protein AP19
  • Golgi adaptor HA1/AP1 adaptin sigma-1A subunit
  • Sigma 1a subunit of AP-1 clathrin
  • sigma1A subunit of AP-1 clathrin adaptor complex
  • SIGMA1A
  • sigma1A-adaptin
  • Sigma-adaptin 1A
  • small 1 (19kD)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001175-M01
Species: Hu
Applications: ELISA, KD, S-ELISA, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NBP2-67710
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP2-67861
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89544
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-33101
Species: Hu
Applications: ICC/IF, WB
NB100-74359
Species: Ch, Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP3-06300
Species: Hu
Applications: ICC/IF, WB
NB100-1063
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP2-92000
Species: Hu, Mu, Rt
Applications: WB
NBP2-99079
Species: Hu
Applications: ICC, ICC/IF, IF, IP, WB
NBP3-15727
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
NBP2-92058
Species: Hu, Mu
Applications: ICC/IF, WB
AF3587
Species: Hu
Applications: CyTOF-ready, ICC, IHC, IP, ICFlow, WB
NBP1-81857
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-49643
Species: Bv, Hu, Pm, Mu
Applications: Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, KO, WB

Publications for AP1S1 Antibody (NBP2-84437) (0)

There are no publications for AP1S1 Antibody (NBP2-84437).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AP1S1 Antibody (NBP2-84437) (0)

There are no reviews for AP1S1 Antibody (NBP2-84437). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AP1S1 Antibody (NBP2-84437) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AP1S1 Products

Bioinformatics Tool for AP1S1 Antibody (NBP2-84437)

Discover related pathways, diseases and genes to AP1S1 Antibody (NBP2-84437). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AP1S1 Antibody (NBP2-84437)

Discover more about diseases related to AP1S1 Antibody (NBP2-84437).
 

Pathways for AP1S1 Antibody (NBP2-84437)

View related products by pathway.

Research Areas for AP1S1 Antibody (NBP2-84437)

Find related products by research area.

Blogs on AP1S1

There are no specific blogs for AP1S1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AP1S1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AP1S1