Angiopoietin-like protein 8/Betatrophin Antibody - Azide and BSA Free

Western Blot: Angiopoietin-like protein 8/Betatrophin Antibody [H00055908-B01P] - Analysis of C19orf80 expression in transfected 293T cell line by C19orf80 polyclonal antibody. Lane 1: C19orf80 transfected lysate(27.61 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Angiopoietin-like protein 8/Betatrophin Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse Angiopoietin-like protein 8/Betatrophin Antibody - Azide and BSA Free (H00055908-B01P) is a polyclonal antibody validated for use in WB. Anti-Angiopoietin-like protein 8/Betatrophin Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: C19orf80 (AAI46553.1, 1 a.a. - 251 a.a.) full-length human protein. MGDALPPFPGAQPLTGRAWLGSSPVMYCTRTARLRTEPWRLLKLRLLYLRPSVMPVPALCLLWALAMVTRPASAAPMGGPELAQHEELTLLFHGTLQLGQALNGVYRTTEGRLTKARNSLGLYGRTIELLGQEVSRGRDAAQELRASLLETQMEEDILQLQAEATAEVLGEVAQAQKVLRDSVQRLEVQLRSAWLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREMVAQQHRLRQIQERLHTAALPA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: ANGPTL8
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:1000
• Application Notes: This product has been QC tested against mammalian transfected lysate.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Immunogen affinity purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Angiopoietin-like protein 8/Betatrophin Antibody - Azide and BSA Free

• Angiopoietin like Protein 8
• Angiopoietin-like Protein 8
• ANGPTL8
• Betatrophin
• C19orf80
• chromosome 19 open reading frame 80
• Gm6484
• hepatocellular carcinoma-associated gene TD26
• hepatocellular carcinoma-associated protein TD26
• Lipasin
• PRO1185
• PVPA599
• RIFL
• TD26
• UNQ599

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Angiopoietin-like protein 8/Betatrophin Antibody (H00055908-B01P)(1)

Publication using H00055908-B01P

• Yi P, Park JS, Melton DAet al. Betatrophin: A Hormone that Controls Pancreatic beta Cell Proliferation. Cell 2013-04-24 [PMID: 23623304] (WB, Human)

FAQs for Angiopoietin-like protein 8/Betatrophin Antibody (H00055908-B01P). (Showing 1 - 2 of 2 FAQ).

1. We would like to buy your product (H00055908-B01P) for conducting western blot of mice tissues. I know H00055908-B01P is made for detecting human TD26. But is it possible to detect mouse TD26 by using your antibody? Do you have any data or did you confirm for this?
   • Unfortunately, the immunogen used to generate H00055908-B01P shares only 73% homology with mouse TD26, so it is not predicted to cross-react. If you would be interested in testing this novel species, please take a look at our Innovator's Reward program.
2. I am interested in your product, TD26 Antibody (H00055908-B01P). I will be happy, if you can provide me some information. Here are my questions. A. I see your antibody tested in human sample. How about cross reactivity with mouse tissue, such as plasma or liver homogenate? Could it be possible to have details about conditions for the assay? B. Any published data with regard to this antibody? Could you send me a links, if you dont mind?
   • H00055908-B01P has not been tested on mouse samples and the immunogen shares only 74% similarity with mouse. There is only a slight chance that it will cross-react. View our Images, Reviews and Publications tab for a list of known publications for this antibody.

Bioinformatics

• Gene Symbol: ANGPTL8
• Entrez:
  • 55908(Human)