Recombinant Human alpha Tubulin 3c GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human alpha Tubulin 3c Protein [H00007278-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human alpha Tubulin 3c GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-418 of Human TUBA3C full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADLCTGLQGFLIFHSFGGGTGSGFASLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDLAALEKDYEEVGVDSVEAEAEEGEEY

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
TUBA3C
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
71.72 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human alpha Tubulin 3c GST (N-Term) Protein

  • alpha Tubulin 3c
  • Alpha-tubulin 2
  • Alpha-tubulin 3C/D
  • bA408E5.3
  • TUBA2
  • TUBA2Tubulin alpha-2 chain
  • TUBA3C
  • TUBA3D
  • tubulin alpha-3C/D chain
  • tubulin, alpha 2
  • tubulin, alpha 3c

Background

TUBA2( AAH11721, 1 a.a. - 419 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-41304
Species: Hu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-61141
Species: Hu
Applications: ICC/IF, IHC
NBP3-06153
Species: Hu
Applications: IHC, IHC-P, WB
MAB994
Species: Mu
Applications: WB
NBP1-79850
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
746-LF/CF
Species: Hu
Applications: BA
NBP2-15291
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-69668
Species: Hu
Applications: WB
NBP2-84247
Species: Hu
Applications: WB
NB100-690
Species: Av, Bv, Ca, Ch, ChHa, Dr, Fu, Gt, Gp, Ha, Hu, Pm, Mu, Pa, Po, Pm, Rb, Rt, Xp, Ye
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP, Simple Western, WB
NBP2-21604
Species: Ch, Dr, Eu, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
273-F9/CF
Species: Hu
Applications: BA
AF746
Species: Hu, Mu
Applications: WB
NBP1-84307
Species: Hu
Applications: ICC/IF, WB
AF3876
Species: Hu, Mu
Applications: IHC, WB
H00007278-P01
Species: Hu
Applications: WB, ELISA, PA, PAGE, AP

Publications for alpha Tubulin 3c Recombinant Protein (H00007278-P01) (0)

There are no publications for alpha Tubulin 3c Recombinant Protein (H00007278-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for alpha Tubulin 3c Recombinant Protein (H00007278-P01) (0)

There are no reviews for alpha Tubulin 3c Recombinant Protein (H00007278-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for alpha Tubulin 3c Recombinant Protein (H00007278-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional alpha Tubulin 3c Products

Bioinformatics Tool for alpha Tubulin 3c Recombinant Protein (H00007278-P01)

Discover related pathways, diseases and genes to alpha Tubulin 3c Recombinant Protein (H00007278-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for alpha Tubulin 3c Recombinant Protein (H00007278-P01)

Discover more about diseases related to alpha Tubulin 3c Recombinant Protein (H00007278-P01).

Research Areas for alpha Tubulin 3c Recombinant Protein (H00007278-P01)

Find related products by research area.

Blogs on alpha Tubulin 3c

There are no specific blogs for alpha Tubulin 3c, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human alpha Tubulin 3c GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TUBA3C