alpha-1D Adrenergic R/ADRA1D Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ADRA1D. Source: E. coli
Amino Acid Sequence: PFRRPTTQLRAKVSSLSHKIRAGGAQRAEAACAQRSEVEAVSLGVPHEVAEGATCQAYELADYSNLRE Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
ADRA1D |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90229. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
25 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for alpha-1D Adrenergic R/ADRA1D Recombinant Protein Antigen
Background
The alpha 1d-adrenoceptor is an Adrenergic Receptor that causes the contraction of smooth muscle and increases intracellular calcium. Expression of the alpha 1d-adrenoceptor has been reported primarily in smooth muscle of arterioles, eye, gut, skin, vein, as well as in other cell types (e.g. salivary gland). Adrenoceptors are also expressed in hippocampus, cerebral cortex, and brainstem. Caution: The name ADRA1A has been used to describe both the alpha 1d adrenoceptor (human chromosome 20) and the alpha 1c adrenoceptor (human chromosome 8), and the alpha 1c adrenoceptor is also known as alpha 1a adrenoceptor.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Ca, Ha, Hu, Pm, Mu, Pm, Rt
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC, IHC, Neut, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, Func, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Mu
Applications: ELISA
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: AC
Publications for alpha-1D Adrenergic R/ADRA1D Protein (NBP1-90229PEP) (0)
There are no publications for alpha-1D Adrenergic R/ADRA1D Protein (NBP1-90229PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for alpha-1D Adrenergic R/ADRA1D Protein (NBP1-90229PEP) (0)
There are no reviews for alpha-1D Adrenergic R/ADRA1D Protein (NBP1-90229PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for alpha-1D Adrenergic R/ADRA1D Protein (NBP1-90229PEP) (0)
Additional alpha-1D Adrenergic R/ADRA1D Products
Research Areas for alpha-1D Adrenergic R/ADRA1D Protein (NBP1-90229PEP)
Find related products by research area.
|
Blogs on alpha-1D Adrenergic R/ADRA1D