AKAP1 Recombinant Protein Antigen

Images

 
There are currently no images for AKAP1 Recombinant Protein Antigen (NBP2-58918PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

AKAP1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AKAP1.

Source: E. coli

Amino Acid Sequence: EHVLELENSKGPSLASLEGEEDKGKSSSSQVVGPVQEEEYVAEKLPSRFIESAHTELAKDDAAPAPPVADAKAQDRGVEGELGNEESLDRNEEGLDRNEEGLDRNEESLDRNEEGLDRNEEIKRAAFQIISQVISEATEQV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
AKAP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58918.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for AKAP1 Recombinant Protein Antigen

  • A kinase (PRKA) anchor protein 1
  • a kinase anchor protein 1, mitochondrial
  • AKAP121
  • AKAP149AKAP 149
  • AKAP84
  • A-kinase anchor protein 1, mitochondrial
  • A-kinase anchor protein 149 kDa
  • A-kinase anchor protein, 149kD
  • D-AKAP1
  • D-AKAP-1
  • Dual specificity A-kinase-anchoring protein 1
  • dual-specificity A-kinase anchoring protein 1
  • MGC1807
  • PRKA1
  • protein kinase A anchoring protein 1
  • protein kinase A1
  • Protein kinase A-anchoring protein 1
  • protein kinase anchoring protein 1
  • S-AKAP84
  • SAKAP84AKAP
  • Spermatid A-kinase anchor protein 84

Background

The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein binds to type I and type II regulatory subunits of PKA and anchors them to the mitochondrion. This protein is speculated to be involved in the cAMP-dependent signal transduction pathway and in directing RNA to a specific cellular compartment.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89163
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-38713
Species: Hu
Applications: IHC,  IHC-P
NBP1-89168
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-46989
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-89170
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-02520
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-89166
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-90196
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-31348
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00011216-M04
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, KD, S-ELISA, WB
AF7197
Species: Hu, Mu
Applications: ICC, IHC, WB
NBP1-89165
Species: Hu
Applications: IHC,  IHC-P
AF2685
Species: Hu
Applications: IHC, Simple Western, WB

Publications for AKAP1 Recombinant Protein Antigen (NBP2-58918PEP) (0)

There are no publications for AKAP1 Recombinant Protein Antigen (NBP2-58918PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AKAP1 Recombinant Protein Antigen (NBP2-58918PEP) (0)

There are no reviews for AKAP1 Recombinant Protein Antigen (NBP2-58918PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for AKAP1 Recombinant Protein Antigen (NBP2-58918PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional AKAP1 Products

Blogs on AKAP1

There are no specific blogs for AKAP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our AKAP1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol AKAP1