Aiolos/IKZF3 Recombinant Protein Antigen

Images

 
There are currently no images for Aiolos/IKZF3 Recombinant Protein Antigen (NBP1-89185PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Aiolos/IKZF3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IKZF3.

Source: E.coli

Amino Acid Sequence: AVLNDYSLTKSHEMENVDSGEGPANEDEDIGDDSMKVKDEYSERDENVLKSEPMGNAEEPEIPYSYSREYNEYENIKLERHVVSFDSSRPTSGKMNCDVCGLSCISFNVL

Protein/Peptide Type
Recombinant Protein Antigen
Gene
IKZF3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-89185. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related protocol, click here.
Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Aiolos/IKZF3 Recombinant Protein Antigen

  • AIO
  • Aiolos
  • IKAROS family zinc finger 3 (Aiolos)
  • Ikaros family zinc finger protein 3
  • IKZF3
  • zinc finger protein Aiolos
  • ZNFN1A3
  • ZNFN1A3subfamily 1A, 3 (Aiolos)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4984
Species: Hu
Applications: WB, Simple Western, ChIP, CyTOF-ready, ICC, ICFlow
NBP2-34122
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45374
Species: Hu
Applications: WB, IHC
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
AF5165
Species: Hu, Mu
Applications: WB
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
20650002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-82689
Species: Hu
Applications: WB, IHC, IHC-P
AF3487
Species: Hu
Applications: WB, IHC, ICC
NBP2-55305
Species: Hu
Applications: WB, ICC/IF
AF1095
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICC, ICFlow
MAB7650
Species: Mu
Applications: WB, IHC
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
NBP2-34099
Species: Hu
Applications: IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
6507-IL/CF
Species: Hu
AF5117
Species: Hu
Applications: WB, IHC

Publications for Aiolos/IKZF3 Recombinant Protein Antigen (NBP1-89185PEP) (0)

There are no publications for Aiolos/IKZF3 Recombinant Protein Antigen (NBP1-89185PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Aiolos/IKZF3 Recombinant Protein Antigen (NBP1-89185PEP) (0)

There are no reviews for Aiolos/IKZF3 Recombinant Protein Antigen (NBP1-89185PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for Aiolos/IKZF3 Recombinant Protein Antigen (NBP1-89185PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Aiolos/IKZF3 Products

Bioinformatics Tool for Aiolos/IKZF3 Recombinant Protein Antigen (NBP1-89185PEP)

Discover related pathways, diseases and genes to Aiolos/IKZF3 Recombinant Protein Antigen (NBP1-89185PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Aiolos/IKZF3 Recombinant Protein Antigen (NBP1-89185PEP)

Discover more about diseases related to Aiolos/IKZF3 Recombinant Protein Antigen (NBP1-89185PEP).
 

Pathways for Aiolos/IKZF3 Recombinant Protein Antigen (NBP1-89185PEP)

View related products by pathway.

PTMs for Aiolos/IKZF3 Recombinant Protein Antigen (NBP1-89185PEP)

Learn more about PTMs related to Aiolos/IKZF3 Recombinant Protein Antigen (NBP1-89185PEP).
 

Research Areas for Aiolos/IKZF3 Recombinant Protein Antigen (NBP1-89185PEP)

Find related products by research area.

Blogs on Aiolos/IKZF3

There are no specific blogs for Aiolos/IKZF3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-4
6507-IL-010/CF
IL-2 [Unconjugated]
202-IL-010/CF
IL-2 [Unconjugated]
202-IL-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Aiolos/IKZF3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol IKZF3
Entrez