AGL Recombinant Protein Antigen

Images

 
There are currently no images for AGL Recombinant Protein Antigen (NBP2-55436PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

AGL Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AGL.

Source: E. coli

Amino Acid Sequence: LAKCLGPFDEWESRLRVAKESGYNMIHFTPLQTLGLSRSCYSLANQLELNPDFSRPNRKYTWNDVGQLVEKLKKEWNVICITDVVYNHTAANSKWIQEHPE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
AGL
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55436.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for AGL Recombinant Protein Antigen

  • amylo-alpha-1, 6-glucosidase, 4-alpha-glucanotransferase
  • GDEamylo-1, 6-glucosidase, 4-alpha-glucanotransferase
  • Glycogen debrancher
  • glycogen debranching enzyme

Background

AGL encodes the glycogen debrancher enzyme which is involved in glycogen degradation. This enzyme has two independent catalytic activities which occur at different sites on the protein: a 4-alpha-glucotransferase activity and a amylo-1,6-glucosidase activity. Mutations in this gene are associated with glycogen storage disease although a wide range of enzymatic and clinical variability occurs which may be due to tissue-specific alternative splicing. Alternatively spliced transcripts encoding different isoforms have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46518
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-83552
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
H00003703-M02
Species: Hu
Applications: ELISA, IHC,  IHC-P, IP, WB
NBP1-81838
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
H00002678-M01
Species: Hu, Mu, Ye
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, S-ELISA, WB
NBP1-85875
Species: Hu, Rt
Applications: IHC,  IHC-P, WB
NBP2-37447
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P
NBP2-01763
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP3-46899
Species: Hu
Applications: ELISA, ICC/IF, WB
AF2854
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-89133
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-86616
Species: Hu
Applications: IHC,  IHC-P, WB

Publications for AGL Recombinant Protein Antigen (NBP2-55436PEP) (0)

There are no publications for AGL Recombinant Protein Antigen (NBP2-55436PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AGL Recombinant Protein Antigen (NBP2-55436PEP) (0)

There are no reviews for AGL Recombinant Protein Antigen (NBP2-55436PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for AGL Recombinant Protein Antigen (NBP2-55436PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional AGL Products

Research Areas for AGL Recombinant Protein Antigen (NBP2-55436PEP)

Find related products by research area.

Blogs on AGL

There are no specific blogs for AGL, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our AGL Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol AGL