ADNP2 Antibody

Images

 
Western Blot: ADNP2 Antibody [NBP1-81468] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: ADNP2 Antibody [NBP1-81468] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & mitochondria.
Immunohistochemistry-Paraffin: ADNP2 Antibody [NBP1-81468] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.
Western Blot: ADNP2 Antibody [NBP1-81468] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ADNP2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TCPVCNELFPSNVYQVHMEVAHKHSESKSGEKLEPEKLAACAPFLKWMREKTVRCLSCKCLVSEEELIHHLLMHGLGCLFCPCTFHDIKGLSEHSRNRHLGKKKLPMDYSNRGFQLDVDANGNLLFPHLDFITILPKEKLGERE
Specificity
Specificity of human, mouse, rat ADNP2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADNP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
123 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
ADNP2 Protein (NBP1-81468PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ADNP2 Antibody

  • ADNP homeobox 2
  • ADNP homeobox protein 2
  • KIAA0863
  • zinc finger protein 508
  • ZNF508

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89236
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00001032-M08
Species: Hu
Applications: WB, ELISA, IP, S-ELISA
NBP2-13215
Species: Hu
Applications: WB, IHC, IHC-P
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-37252
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP
NBP1-81468
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ADNP2 Antibody (NBP1-81468) (0)

There are no publications for ADNP2 Antibody (NBP1-81468).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADNP2 Antibody (NBP1-81468) (0)

There are no reviews for ADNP2 Antibody (NBP1-81468). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ADNP2 Antibody (NBP1-81468) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ADNP2 Products

Bioinformatics Tool for ADNP2 Antibody (NBP1-81468)

Discover related pathways, diseases and genes to ADNP2 Antibody (NBP1-81468). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADNP2 Antibody (NBP1-81468)

Discover more about diseases related to ADNP2 Antibody (NBP1-81468).
 

Pathways for ADNP2 Antibody (NBP1-81468)

View related products by pathway.

Blogs on ADNP2

There are no specific blogs for ADNP2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ADNP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ADNP2
Entrez
Uniprot