ADNP2 Antibody - BSA Free

Western Blot: ADNP2 Antibody [NBP1-81468] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunocytochemistry/Immunofluorescence: ADNP2 Antibody [NBP1-81468] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & mitochondria.

Immunohistochemistry-Paraffin: ADNP2 Antibody [NBP1-81468] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Western Blot: ADNP2 Antibody [NBP1-81468] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ADNP2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TCPVCNELFPSNVYQVHMEVAHKHSESKSGEKLEPEKLAACAPFLKWMREKTVRCLSCKCLVSEEELIHHLLMHGLGCLFCPCTFHDIKGLSEHSRNRHLGKKKLPMDYSNRGFQLDVDANGNLLFPHLDFITILPKEKLGERE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ADNP2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Theoretical MW: 123 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  ADNP2 Recombinant Protein Antigen (NBP1-81468PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ADNP2 Antibody - BSA Free

• ADNP homeobox 2
• ADNP homeobox protein 2
• KIAA0863
• zinc finger protein 508
• ZNF508

Background

ADNP2, or ADNP homeobox protein 2, consists of a 1,131 amino acid isoform that is 123 kDa, and is involved in the regulation of transcription in the nucleus. Current research on ADNP2 includes its involvement in and relation to schizophrenia and neuronitis. This protein interacts with NFYC, CBX1, CBX3, CBX5, and UBC during the processes of transcription, negative regulation of cell death, positive regulation of cell growth, and neuron differentiation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ADNP2
• Entrez:
  • 22850(Human)
• Uniprot:
  • Q6IQ32(Human)