ADAMTS9 Recombinant Protein Antigen

Images

 
There are currently no images for ADAMTS9 Protein (NBP1-82916PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ADAMTS9 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ADAMTS9.

Source: E. coli

Amino Acid Sequence: VMCVNYSDHVIDRSECDQDYIPETDQDCSMSPCPQRTPDSGLAQHPFQNEDYRPRSASPSRTHVLGGNQWRTGPWGACSSTC

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ADAMTS9
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82916.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ADAMTS9 Recombinant Protein Antigen

  • ADAM metallopeptidase with thrombospondin type 1 motif, 9
  • ADAMTS-9,9
  • FLJ42955

Background

ADAMTS proteases are secreted enzymes containing a prometalloprotease domain of the reprolysin type. The ADAMTS proteases function in processing of procollagens and von Willebrand factor as well as catabolism of aggrecan, versican and brevican. They have been demonstrated to have important roles in connective tissue organization, coagulation, inflammation, arthritis, angiogenesis and cell migration. ADAMTS9 is closest in homology to ADAMTS20, sharing 54% overall identity, and like ADAMTS20 ADAMTS9 gas a GON like domain at the carboxyterminal end. The GON domain at the carboxyterminal end is similar to the GON1 protein in C. elegans, mutations of which lead to defective gonadal development. ADAMTS9 is expressed in ovary and testis, but little is known about the role of ADAMTS9 in reproductive organs. ADAMTS9 is also expressed in the heart, placenta, lung, skeletal tissue, and pancreas, so the protein must have wider functions than just gonadal development. ADAMTS9, like ADAMTS20, has a total of 15 thrombospondin like domains. The first TS domain begins shortly after the catalytic and disintegrin domains. TS domains 2 to 6 follow a spacer domain, followed by linker domain 1, then TS domains 7 & 8, linker domain 2, and then TS domains 9 to 15. In other ADAMTS proteins the TS motifs are thought to bind to the ECM. The ADAMTS proteins contain at least one prohormone convertase cleavage site, although it appears that one site is used preferentially, and cleavage of the propeptide domain at this site generates active enzymes. For ADAMTS9, this site is the RRTKR sequence, and the mature ADAMTS9 has an aminoterminal sequence of FLSYPR. The catalytic site of ADAMTS9 is most like ADAMTS1, 14 and 15, with an HExxHVFNMxH sequence, perhaps giving these enzymes some shared specificity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DY4307-05
Species: Hu
Applications: ELISA
DY2198-05
Species: Hu
Applications: ELISA
AF5867
Species: Hu, Mu
Applications: IHC, IP, WB
NBP3-13885
Species: Hu
Applications: Flow, ICC/IF,  IHC-P, IP, PA, WB
NB100-74350
Species: Bv, Ca, Hu, Mu, Po, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-81807
Species: Hu
Applications: IHC,  IHC-P
NBP1-19083
Species: Hu
Applications: ICC/IF, WB
NBP1-85432
Species: Hu, Mu
Applications: COMET, IHC,  IHC-P, mIF
NBP3-45255
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
AF3735
Species: Hu
Applications: IHC, WB
MAB4734
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
NBP1-88540
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF5465
Species: Hu
Applications: IP, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP1-85589
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
DVE00
Species: Hu
Applications: ELISA
NBP1-32796
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP2-02627
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB

Publications for ADAMTS9 Protein (NBP1-82916PEP) (0)

There are no publications for ADAMTS9 Protein (NBP1-82916PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADAMTS9 Protein (NBP1-82916PEP) (0)

There are no reviews for ADAMTS9 Protein (NBP1-82916PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ADAMTS9 Protein (NBP1-82916PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ADAMTS9 Products

Research Areas for ADAMTS9 Protein (NBP1-82916PEP)

Find related products by research area.

Blogs on ADAMTS9

There are no specific blogs for ADAMTS9, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ADAMTS9 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ADAMTS9