Recombinant Human ACTRT2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ACTRT2 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 209 - 299 of Human ARPM2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:DKGLVDDIKKKLCYVALEPEKELSRRPEEVLREYKLPDGNIISLGDPLHQAPEALFVPQQLGSQSPGLSNMVSSSITKCDTDIQKILFGEI

Protein/Peptide Type
Partial Recombinant Protein
Gene
ACTRT2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ACTRT2 Protein

  • actin-related protein hArpM2
  • Actin-related protein M2
  • actin-related protein T2
  • ARPM2HARPM2
  • ARPT2
  • Arp-T2
  • FLJ25424

Background

ACTRT2 - actin-related protein M2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34951
Species: Hu
H00057016-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-90910
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88838
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
MAB4675
Species: Mu
Applications: WB, IHC, Neut
NBP2-14306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-53182
Species: Hu
Applications: WB
NBP2-15278
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91988
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-56428
Species: Hu
Applications: ICC/IF, IHC-P
H00140625-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for ACTRT2 Partial Recombinant Protein (H00140625-Q01) (0)

There are no publications for ACTRT2 Partial Recombinant Protein (H00140625-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACTRT2 Partial Recombinant Protein (H00140625-Q01) (0)

There are no reviews for ACTRT2 Partial Recombinant Protein (H00140625-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ACTRT2 Partial Recombinant Protein (H00140625-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ACTRT2 Products

Bioinformatics Tool for ACTRT2 Partial Recombinant Protein (H00140625-Q01)

Discover related pathways, diseases and genes to ACTRT2 Partial Recombinant Protein (H00140625-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ACTRT2

There are no specific blogs for ACTRT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ACTRT2 Antibody
NBP1-89006

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ACTRT2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ACTRT2