ACSF3 Antibody

Images

 
Western Blot: ACSF3 Antibody [NBP2-83924] - Host: Rabbit. Target Name: ACSF3. Sample Type: MCF7 Whole cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ACSF3 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of human ACSF3. Peptide sequence: YWNKPEETKSAFTLDGWFKTGDTVVFKDGQYWIRGRTSVDIIKTGGYKVS The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
ACSF3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ACSF3 Antibody

  • acyl-CoA synthetase family member 3
  • acyl-CoA synthetase family member 3, mitochondrial
  • EC 6.2.1
  • EC 6.2.1.-
  • FLJ39242

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1126
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
NBP1-32797
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-92089
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-90276
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67309
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-90260
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-57636
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-31368
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-43435
Species: Hu, Mu
Applications: Flow, WB
NBP2-83924
Species: Hu
Applications: WB

Publications for ACSF3 Antibody (NBP2-83924) (0)

There are no publications for ACSF3 Antibody (NBP2-83924).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACSF3 Antibody (NBP2-83924) (0)

There are no reviews for ACSF3 Antibody (NBP2-83924). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ACSF3 Antibody (NBP2-83924) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ACSF3 Products

Bioinformatics Tool for ACSF3 Antibody (NBP2-83924)

Discover related pathways, diseases and genes to ACSF3 Antibody (NBP2-83924). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACSF3 Antibody (NBP2-83924)

Discover more about diseases related to ACSF3 Antibody (NBP2-83924).
 

Pathways for ACSF3 Antibody (NBP2-83924)

View related products by pathway.

Research Areas for ACSF3 Antibody (NBP2-83924)

Find related products by research area.

Blogs on ACSF3

There are no specific blogs for ACSF3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACSF3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACSF3