ACPL2 Antibody

Images

 
Immunohistochemistry-Paraffin: ACPL2 Antibody [NBP1-83577] - Staining of human testis shows moderate cytoplasmic positivity in Leydig cells.
Immunohistochemistry-Paraffin: ACPL2 Antibody [NBP1-83577] - Staining of human epididymis shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ACPL2 Antibody [NBP1-83577] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: ACPL2 Antibody [NBP1-83577] - Staining of human skin shows no positivity in keratinocytes as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ACPL2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: STPKNGMSSKSRKRIMPDPVTEPPVTDPVYEALLYCNIPSVAERSMEGHAPHHFKLVSVHVFIRHGDRYPLYVIPKTKRPEIDCTLVANRKPYHPKLEAFISHMSKGSGASFESPLNSLPLYPNHP
Predicted Species
Mouse (92%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACPL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
55 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
ACPL2 Protein (NBP1-83577PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ACPL2 Antibody

  • acid phosphatase-like 2
  • acid phosphatase-like protein 2
  • EC 3.1.3.2
  • FLJ23751

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

M1300CB
Species: Mu
Applications: ELISA
AF7117
Species: Hu, Mu
Applications: ICC, IHC, WB
NBP1-87751
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-80611
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-03062
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, IHC, IHC-P, WB
NBP2-16134
Species: Hu
Applications: IHC, IHC-P, IP, WB
NBP1-81049
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-93638
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP2-52455
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-83577
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for ACPL2 Antibody (NBP1-83577) (0)

There are no publications for ACPL2 Antibody (NBP1-83577).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACPL2 Antibody (NBP1-83577) (0)

There are no reviews for ACPL2 Antibody (NBP1-83577). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ACPL2 Antibody (NBP1-83577) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ACPL2 Products

Bioinformatics Tool for ACPL2 Antibody (NBP1-83577)

Discover related pathways, diseases and genes to ACPL2 Antibody (NBP1-83577). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACPL2 Antibody (NBP1-83577)

Discover more about diseases related to ACPL2 Antibody (NBP1-83577).

Blogs on ACPL2

There are no specific blogs for ACPL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACPL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACPL2
Entrez
Uniprot