ACBD6 Antibody

Images

 
Immunohistochemistry-Paraffin: ACBD6 Antibody [NBP1-81158] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ACBD6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EGRALLHWACDRGHKELVTVLLQHRADINCQDNEGQTALHYASACEFLDIVELLLQSGADPTLRDQDGCLPEEVTGCKTVSLVLQRHTTGKA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACBD6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH6 retrieval is recommended.
Control Peptide
ACBD6 Protein (NBP1-81158PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ACBD6 Antibody

  • acyl-CoA binding domain containing 6
  • acyl-CoA-binding domain-containing protein 6
  • acyl-Coenzyme A binding domain containing 6
  • MGC2404

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88923
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-82867
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00010162-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NB120-16518
Species: Hu, Mu, Po, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-88921
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-15252
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-81158
Species: Hu
Applications: IHC, IHC-P

Publications for ACBD6 Antibody (NBP1-81158) (0)

There are no publications for ACBD6 Antibody (NBP1-81158).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACBD6 Antibody (NBP1-81158) (0)

There are no reviews for ACBD6 Antibody (NBP1-81158). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ACBD6 Antibody (NBP1-81158) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ACBD6 Products

Bioinformatics Tool for ACBD6 Antibody (NBP1-81158)

Discover related pathways, diseases and genes to ACBD6 Antibody (NBP1-81158). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACBD6 Antibody (NBP1-81158)

Discover more about diseases related to ACBD6 Antibody (NBP1-81158).
 

Pathways for ACBD6 Antibody (NBP1-81158)

View related products by pathway.

Blogs on ACBD6

There are no specific blogs for ACBD6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACBD6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACBD6
Entrez
Uniprot