ACBD4 Antibody


Immunocytochemistry/ Immunofluorescence: ACBD4 Antibody [NBP2-14258] - Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm & vesicles.
Immunohistochemistry-Paraffin: ACBD4 Antibody [NBP2-14258] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

ACBD4 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: SAYITEMKLVAQKVIDTVPLGEVAEDMFGYFEPLYQVIPDMPRPPETFLR RVTGWKEQVVNGDVGAVSEPPCLPKEPA
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ACBD4 Protein (NBP2-14258PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (87%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ACBD4 Antibody

  • acyl-CoA binding domain containing 4
  • acyl-CoA-binding domain-containing protein 4
  • acyl-Coenzyme A binding domain containing 4
  • FLJ13322
  • FLJ90623


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt, Ch, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ACBD4 Antibody (NBP2-14258) (0)

There are no publications for ACBD4 Antibody (NBP2-14258).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACBD4 Antibody (NBP2-14258) (0)

There are no reviews for ACBD4 Antibody (NBP2-14258). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ACBD4 Antibody (NBP2-14258) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ACBD4 Products

Bioinformatics Tool for ACBD4 Antibody (NBP2-14258)

Discover related pathways, diseases and genes to ACBD4 Antibody (NBP2-14258). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACBD4 Antibody (NBP2-14258)

Discover more about diseases related to ACBD4 Antibody (NBP2-14258).

Pathways for ACBD4 Antibody (NBP2-14258)

View related products by pathway.

Blogs on ACBD4

There are no specific blogs for ACBD4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ACBD4 Antibody and receive a gift card or discount.


Gene Symbol ACBD4