ACAP3 Antibody

Images

 
Immunohistochemistry-Paraffin: ACAP3 Antibody [NBP2-14257] Staining of human small intestine shows strong membranous and cytoplasmic positivity.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ACAP3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VKLCSGMVEAGKAYVSTSRLFVSGVRDLSQQCQGDTVISECLQRFADSLQ EVVNYHMILFDQAQRSVRQQLQSFVKE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACAP3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ACAP3 Protein (NBP2-14257PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ACAP3 Antibody

  • ANK repeat and PH domain-containing protein 3
  • ArfGAP with coiled-coil, ankyrin repeat and PH domains 3
  • centaurin, beta 5
  • centaurin-beta-5
  • CENTB5
  • cnt-b5
  • KIAA1716

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-33581
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-33498
Species: Hu
Applications: IHC, IHC-P
NBP1-32452
Species: Hu, Mu, Rt
Applications: WB
NBP1-89278
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85004
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ACAP3 Antibody (NBP2-14257) (0)

There are no publications for ACAP3 Antibody (NBP2-14257).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACAP3 Antibody (NBP2-14257) (0)

There are no reviews for ACAP3 Antibody (NBP2-14257). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ACAP3 Antibody (NBP2-14257) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ACAP3 Products

ACAP3 NBP2-14257

Bioinformatics Tool for ACAP3 Antibody (NBP2-14257)

Discover related pathways, diseases and genes to ACAP3 Antibody (NBP2-14257). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACAP3 Antibody (NBP2-14257)

Discover more about diseases related to ACAP3 Antibody (NBP2-14257).

Blogs on ACAP3

There are no specific blogs for ACAP3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACAP3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACAP3
Entrez
Uniprot