ACAD10 Recombinant Protein Antigen

Images

 
There are currently no images for ACAD10 Recombinant Protein Antigen (NBP2-49511PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ACAD10 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ACAD10.

Source: E. coli

Amino Acid Sequence: MCVRSCFQSPRLQWVWRTAFLKHTQRRHQGSHRWTHLGGSTYRAVIFDMGGVLIPSPGRVAAEWEVQNRIPSGTILKALMEGGEN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ACAD10
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49511.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ACAD10 Recombinant Protein Antigen

  • ACAD-10
  • acyl-CoA dehydrogenase family member 10
  • acyl-CoA dehydrogenase family, member 10
  • acyl-Coenzyme A dehydrogenase family, member 10
  • EC 1.3.99.-
  • MGC5601

Background

ACAD10 encodes a member of the acyl-CoA dehydrogenase family of enzymes (ACADs), which participate in the beta-oxidation of fatty acids in mitochondria. The encoded enzyme contains a hydrolase domain at the N-terminal portion, a serine/threonine protein kinase catlytic domain in the central region, and a conserved ACAD domain at the C-terminus. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89290
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-82749
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-14255
Species: Hu
Applications: IHC,  IHC-P
NBP2-03047
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-48549
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89292
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-89289
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-15238
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
AF4096
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP1-85702
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-49511PEP
Species: Hu
Applications: AC

Publications for ACAD10 Recombinant Protein Antigen (NBP2-49511PEP) (0)

There are no publications for ACAD10 Recombinant Protein Antigen (NBP2-49511PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACAD10 Recombinant Protein Antigen (NBP2-49511PEP) (0)

There are no reviews for ACAD10 Recombinant Protein Antigen (NBP2-49511PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ACAD10 Recombinant Protein Antigen (NBP2-49511PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ACAD10 Products

Research Areas for ACAD10 Recombinant Protein Antigen (NBP2-49511PEP)

Find related products by research area.

Blogs on ACAD10

There are no specific blogs for ACAD10, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ACAD10 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ACAD10