AC1 Antibody (3F12) - Azide and BSA Free

• Reactivity: Hu
• Applications: ELISA
• Clone: 3F12
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

AC1 Antibody (3F12) - Azide and BSA Free Summary

• Immunogen: C4orf6 (NP_005741, 1 a.a. ~ 93 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDTQKQIHKTHNSKNQFFTIFFFLSVEFGKEGTRKNFYLLLSIGHYGRKSRRADLGTADTADKTEPECFAASWTFDPNPSVTVSGAHSTAVHQ
• Specificity: C4orf6 - chromosome 4 open reading frame 6
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: C4ORF6
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
• Application Notes: Antibody reactive against recombinant protein on ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for AC1 Antibody (3F12) - Azide and BSA Free

• aC1
• chromosome 4 open reading frame 6
• expressed in neuroblastoma
• Protein AC1

Background

This gene is expressed in neuroblastoma; however, the function of this gene is not yet determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: C4ORF6
• Entrez:
  • 10141(Human)
• Uniprot:
  • NP_005741(Human)