| Immunogen | Synthetic peptides corresponding to PRTFDC1(phosphoribosyl transferase domain containing 1) The peptide sequence was selected from the N terminal of PRTFDC1.
Peptide sequence AGSSEEAPDYGRGVVIMDDWPGYDLNLFTYPQHYYGDLEYVLIPHGIIVD. |
| Predicted Species | Porcine (100%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PRTFDC1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | This is a rabbit polyclonal antibody against PRTFDC1 and was validated on Western blot. |
| Theoretical MW | 26 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS and 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for PRTFDC1 Antibody (NBP1-54892)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry Integrin alpha 8 Antibody [Unconjugated]](https://images.novusbio.com/images2/Integrin_alpha_8_AF4076_Immunocytochemistry__Immunofluorescence_17437.jpg)
![Western Blot Integrin alpha 8 Antibody [Unconjugated]](https://images.novusbio.com/images2/Integrin_alpha_8_AF4076_Western_Blot_20029.jpg)
![Simple Western Integrin alpha 8 Antibody [Unconjugated]](https://images.novusbio.com/images2/Integrin_alpha_8_AF4076_Simple_Western_20113.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)