Recombinant Human ZNF83 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human ZNF83 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-111 of Human ZNF83

Source: Wheat Germ

Amino Acid Sequence: MHGRKDDAQKQPVKNQLGLNPQSHLPELQLFQAEGKIYKYDHMEKSVNSSSLVSPPQRISSTVKTHISHTYECNFVDSLFTQKEKANIGTEHYKCNERGKAFHQGLHFTIH

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ZNF83
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
37.95 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ZNF83 Protein

  • FLJ11015
  • FLJ30097
  • FLJ90585
  • HPF1
  • MGC33853
  • Zinc finger protein 816BFLJ14876
  • zinc finger protein 83 (HPF1)
  • zinc finger protein 83
  • Zinc finger protein HPF1
  • ZNF816B

Background

ZNF83 - zinc finger protein 83 (HPF1)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1032
Species: Hu, Mu, Rt, Ba
Applications: WB, ICC/IF, IHC
NBP1-19344
Species: Hu, Mu, Rt, Bv
Applications: WB, Simple Western, IHC, IHC-P
AF4186
Species: Hu
Applications: WB, ICC
PP-H7147-00
Species: Hu
Applications: WB, IHC, IP
NBP1-85488
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01397
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-81427
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-01437
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, IHC, IHC-P
H00001549-P01
Species: Hu
NBP2-67020
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00055769-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for ZNF83 Partial Recombinant Protein (H00055769-Q01) (0)

There are no publications for ZNF83 Partial Recombinant Protein (H00055769-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF83 Partial Recombinant Protein (H00055769-Q01) (0)

There are no reviews for ZNF83 Partial Recombinant Protein (H00055769-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF83 Partial Recombinant Protein (H00055769-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZNF83 Products

Bioinformatics Tool for ZNF83 Partial Recombinant Protein (H00055769-Q01)

Discover related pathways, diseases and genes to ZNF83 Partial Recombinant Protein (H00055769-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ZNF83

There are no specific blogs for ZNF83, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ZNF83 Antibody
NBP1-83789

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ZNF83 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF83