ZNF577 Antibody

Western Blot: ZNF577 Antibody [NBP2-31013] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue

Immunocytochemistry/Immunofluorescence: ZNF577 Antibody [NBP2-31013] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.

Immunohistochemistry: ZNF577 Antibody [NBP2-31013] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.

Product Discontinued

ZNF577 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RETAINSLTVEKPSSRSHTSLYMSELIQEQKTVNTVPIEMPSSGTPPLLNKSERLVGRNVVIVEQPFPRNQAFVVNQEFEQRISLTNEVNVAPSV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZNF577
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ZNF577 Antibody

• FLJ32291
• MGC4400
• zinc finger protein 577

Background

ZNF577 may be involved in transcriptional regulation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZNF577
• Uniprot:
  • Q9BSK1(Human)