ZNF555 Antibody

Images

 
Western Blot: ZNF555 Antibody [NBP1-80167] - 293T cell lysate, Antibody Titration: 0.2-1 ug/ml
Immunohistochemistry-Paraffin: ZNF555 Antibody [NBP1-80167] - Human Pancrease (Epithelial cells of acinus indicated with arrows), 4-8ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF555 Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human ZNF555. Peptide sequence PHLNLYKKIPPGVKQYEYNTYGKVFMHRRTSLKSPITVHTGHKPYQCQEC.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF555
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against ZNF555 and was validated on Western Blot and immunohistochemistry.
Theoretical MW
73 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ZNF555 Antibody

  • FLJ41894
  • MGC26707
  • zinc finger protein 555

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-61856
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-84310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56352
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF
NBP1-57558
Species: Hu, Mu
Applications: WB

Publications for ZNF555 Antibody (NBP1-80167) (0)

There are no publications for ZNF555 Antibody (NBP1-80167).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF555 Antibody (NBP1-80167) (0)

There are no reviews for ZNF555 Antibody (NBP1-80167). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF555 Antibody (NBP1-80167) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for ZNF555 Antibody (NBP1-80167)

Discover related pathways, diseases and genes to ZNF555 Antibody (NBP1-80167). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF555 Antibody (NBP1-80167)

Discover more about diseases related to ZNF555 Antibody (NBP1-80167).

Blogs on ZNF555

There are no specific blogs for ZNF555, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF555 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF555
Uniprot