Recombinant Human ZNF496 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ZNF496 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 485 - 585 of Human ZNF496 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:HLQPDRLQPVEKREQAASEDADKGPKEPLENGKAKLSFQCCECGKAFQRHDHLARHRSHFHLKDKARPFQCRYCVKSFTQNYDLLRHERLHMKRRSKQALN

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
ZNF496

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ZNF496 Protein

  • zinc finger protein 232
  • ZSCAN11Zinc finger and SCAN domain-containing protein 11

Background

ZNF496 - zinc finger protein 496

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1744
Species: Hu
Applications: IHC-P
NB100-2214
Species: Hu, Mu, Rb
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00005956-R02
Species: Hu
NBP2-07996
Species: Hu
H00008360-R01
Species: Hu
NBL1-11570
Species: Hu
NBL1-11569
Species: Hu
NBP2-10888
Species: Hu
NB21-2024
Species: Hu, Mu, Rt, Ma
Applications: WB, ChIP, DB, ICC/IF
H00008365-M01
Species: Hu
Applications: ELISA, ICC/IF
NBL1-11567
Species: Hu
NB100-295
Species: Hu, Rt, Mu(-)
Applications: WB, EM, ICC/IF, IHC-P
AF6394
Species: Hu
Applications: WB, IP
H00084838-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for ZNF496 Partial Recombinant Protein (H00084838-Q01) (0)

There are no publications for ZNF496 Partial Recombinant Protein (H00084838-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF496 Partial Recombinant Protein (H00084838-Q01) (0)

There are no reviews for ZNF496 Partial Recombinant Protein (H00084838-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF496 Partial Recombinant Protein (H00084838-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZNF496 Products

Bioinformatics Tool for ZNF496 Partial Recombinant Protein (H00084838-Q01)

Discover related pathways, diseases and genes to ZNF496 Partial Recombinant Protein (H00084838-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF496 Partial Recombinant Protein (H00084838-Q01)

Discover more about diseases related to ZNF496 Partial Recombinant Protein (H00084838-Q01).

Blogs on ZNF496

There are no specific blogs for ZNF496, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ZNF496 Antibody (2B3)
H00084838-M08

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ZNF496 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF496