ZNF483 Antibody


Immunocytochemistry/ Immunofluorescence: ZNF483 Antibody [NBP2-31592] - Immunofluorescent staining of human cell line RH-30 shows localization to nucleoli.
Immunohistochemistry-Paraffin: ZNF483 Antibody [NBP2-31592] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

ZNF483 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: LLENLRNLEFLDFPVSKLELISQLKWVELPWLLEEVSKSSRLDESALDKIIERCLRDDDHGLMEESQQYCGSSEEDHGNQGNSKG
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZNF483 Protein (NBP2-31592PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ZNF483 Antibody

  • BMZF-2zinc finger 2, bone marrow
  • BMZF2zinc finger protein 27 (KOX 22)
  • Bone marrow zinc finger 2
  • KOX22Zinc finger protein 233
  • zinc finger protein 224
  • Zinc finger protein 255Zinc finger protein KOX22
  • Zinc finger protein 27
  • ZNF255zinc finger protein ZNF255
  • ZNF27ZNF233


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ChIP, IP
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ha, Rb
Applications: WB, ChIP, GS, ICC/IF, IHC, IHC-P, IP, ICC, IF

Publications for ZNF483 Antibody (NBP2-31592) (0)

There are no publications for ZNF483 Antibody (NBP2-31592).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF483 Antibody (NBP2-31592) (0)

There are no reviews for ZNF483 Antibody (NBP2-31592). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZNF483 Antibody (NBP2-31592) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ZNF483 Products

Bioinformatics Tool for ZNF483 Antibody (NBP2-31592)

Discover related pathways, diseases and genes to ZNF483 Antibody (NBP2-31592). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF483 Antibody (NBP2-31592)

Discover more about diseases related to ZNF483 Antibody (NBP2-31592).

Pathways for ZNF483 Antibody (NBP2-31592)

View related products by pathway.

Blogs on ZNF483

There are no specific blogs for ZNF483, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ZNF483 Antibody and receive a gift card or discount.


Gene Symbol ZNF483