Recombinant Human ZNF45 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ZNF45 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-682 of Human ZNF45 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MTKSKEAVTFKDVAVVFSEEELQLLDLAQRKLYRDVMLENFRNVVSVGHQSTPDGLPQLEREEKLWMMKMATQRDNSSGAKNLKEMETLQEVGLRYLPHEELFCSQIWQQITRELIKYQDSVVNIQRTGCQLEKRDDLHYKDEGFSNQSSHLQVHRVHTGEKPYKGEHCVKSFSWSSHLQINQRAHAGEKPYKCEKCDNAFRRFSSLQAHQRVHSRAKSYTNDASYRSFSQRSHLPHHQRVPTGENPYKYEECGRNVGKSSHCQAPLIVHTGEKPYKCEECGVGFSQRSYLQVHLKVHTGKKPYKCEECGKSFSWRSRLQAHERIHTGEKPYKCNACGKSFSYSSHLNIHCRIHTGEKPYKCEECGKGFSVGSHLQAHQISHTGEKPYKCEECGKGFCRASNLLDHQRGHTGEKPYQCDACGKGFSRSSDFNIHFRVHTGEKPYKCEECGKGFSQASNLLAHQRGHTGEKPYKCGTCGKGFSRSSDLNVHCRIHTGEKPYKCERCGKAFSQFSSLQVHQRVHTGEKPYQCAECGKGFSVGSQLQAHQRCHTGEKPYQCEECGKGFCRASNFLAHRGVHTGEKPYRCDVCGKRFRQRSYLQAHQRVHTGERPYKCEECGKVFSWSSYLQAHQRVHTGEKPYKCEECGKGFSWSSSLIIHQRVHADDEGDKDFPSSEDSHRKTR

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
ZNF45

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ZNF45 Protein

  • HZF1Zinc finger protein HZF1
  • KIAA2007
  • zinc finger protein 1
  • zinc finger protein 266

Background

ZNF45( AAH37575, 1 a.a. - 683 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84108
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-30794
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-59679
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13552
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81758
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13557
Species: Hu
Applications: IHC, IHC-P
NBP1-81347
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00007576-P01
Species: Hu
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-13577
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-30999
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-92619
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49161
Species: Hu
Applications: IHC
NBP1-79358
Species: Hu
Applications: WB
NBP1-82897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89064
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-30747
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81344
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF4265
Species: Hu, Mu, Rt
Applications: WB
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready

Publications for ZNF45 Recombinant Protein (H00007596-P01) (0)

There are no publications for ZNF45 Recombinant Protein (H00007596-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF45 Recombinant Protein (H00007596-P01) (0)

There are no reviews for ZNF45 Recombinant Protein (H00007596-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF45 Recombinant Protein (H00007596-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZNF45 Products

Bioinformatics Tool for ZNF45 Recombinant Protein (H00007596-P01)

Discover related pathways, diseases and genes to ZNF45 Recombinant Protein (H00007596-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF45 Recombinant Protein (H00007596-P01)

Discover more about diseases related to ZNF45 Recombinant Protein (H00007596-P01).
 

Pathways for ZNF45 Recombinant Protein (H00007596-P01)

View related products by pathway.

PTMs for ZNF45 Recombinant Protein (H00007596-P01)

Learn more about PTMs related to ZNF45 Recombinant Protein (H00007596-P01).

Blogs on ZNF45

There are no specific blogs for ZNF45, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ZNF45 Antibody
NBP1-32382

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ZNF45 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF45