ZNF396 Antibody (2F8)

Images

 
Western Blot: ZNF396 Antibody (2F8) [H00252884-M01] - Analysis of ZNF396 expression in transfected 293T cell line by ZNF396 monoclonal antibody (M01), clone 2F8.Lane 1: ZNF396 transfected lysate(38.3 KDa).Lane 2: ...read more
Immunocytochemistry/ Immunofluorescence: ZNF396 Antibody (2F8) [H00252884-M01] - Analysis of monoclonal antibody to ZNF396 on HeLa cell . Antibody concentration 10 ug/ml.
Sandwich ELISA: ZNF396 Antibody (2F8) [H00252884-M01] - Detection limit for recombinant GST tagged ZNF396 is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, S-ELISA
Clone
2F8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ZNF396 Antibody (2F8) Summary

Immunogen
ZNF396 (NP_665699.1, 131 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ERELDGPKQIFFGRRKDMIAEKLAPSEITEELPSSQLMPVKKQLQGASWELQSLRPHDEDIKTTNVKSASRQKTSLGIELHCNVSNILHMNGSQSSTYRG
Specificity
ZNF396 - zinc finger protein 396 (2F8)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ZNF396
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ZNF396 Antibody (2F8)

  • KIAA1388
  • MGC126816
  • Zfp319
  • zinc finger protein 319

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00084307-M02
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
MAB7265
Species: Mu
Applications: IHC, WB
NBP1-88099
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
AF6589
Species: Hu
Applications: WB
NBP2-67599
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-82866
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-75468
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-78984
Species: Hu, Mu
Applications: DB, ICC/IF, IHC, IHC-P, IP, WB
NBP1-85710
Species: Hu
Applications: IHC, IHC-P
NBP3-09197
Species: Hu
Applications: WB
NBP1-46852
Species: Hu, Mu
Applications: IHC, IHC-P, WB
H00252884-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA

Publications for ZNF396 Antibody (H00252884-M01) (0)

There are no publications for ZNF396 Antibody (H00252884-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF396 Antibody (H00252884-M01) (0)

There are no reviews for ZNF396 Antibody (H00252884-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ZNF396 Antibody (H00252884-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF396 Products

Array H00252884-M01

Bioinformatics Tool for ZNF396 Antibody (H00252884-M01)

Discover related pathways, diseases and genes to ZNF396 Antibody (H00252884-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ZNF396

There are no specific blogs for ZNF396, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF396 Antibody (2F8) and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF396
Entrez
Uniprot