ZNF334 Antibody


Immunocytochemistry/ Immunofluorescence: ZNF334 Antibody [NBP2-13567] - Immunofluorescent staining of human cell line SH-SY5Y shows localization to nucleus & cytosol.
Immunohistochemistry-Paraffin: ZNF334 Antibody [NBP2-13567] - Staining of human duodenum shows strong cytoplasmic positivity in endocrine cells.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

ZNF334 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: HTGEKHGVFNKCGRISIVKSNCSQCKRMNTKENLYECSEHGHAVSKNSHL IVHQ
Specificity of human ZNF334 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZNF334 Protein (NBP2-13567PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ZNF334 Antibody

  • DKFZp586G1122
  • Hzf
  • HZFzinc finger protein 385
  • RZFHematopoietic zinc finger protein
  • ZFP385
  • zinc finger protein 385A
  • ZNF385Retinal zinc finger protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, AgAct
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for ZNF334 Antibody (NBP2-13567) (0)

There are no publications for ZNF334 Antibody (NBP2-13567).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF334 Antibody (NBP2-13567) (0)

There are no reviews for ZNF334 Antibody (NBP2-13567). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZNF334 Antibody (NBP2-13567) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ZNF334 Products

Bioinformatics Tool for ZNF334 Antibody (NBP2-13567)

Discover related pathways, diseases and genes to ZNF334 Antibody (NBP2-13567). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF334 Antibody (NBP2-13567)

Discover more about diseases related to ZNF334 Antibody (NBP2-13567).

Blogs on ZNF334

There are no specific blogs for ZNF334, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ZNF334 Antibody and receive a gift card or discount.


Gene Symbol ZNF334