Recombinant Human ZNF232 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ZNF232 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 181-280 of Human ZNF232 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:EKKESLGAAQEALSIQLQPKETQPFPKSEQVYLHFLSVVTEDGPEPKDKGSLPQPPITEVESQVFSEKLATDTSTFEATSEGTLELQQRNPKAERLRWSP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
ZNF232
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ZNF232 Protein

  • zinc finger protein 500
  • Zinc finger protein with KRAB and SCAN domains 18
  • ZKSCAN18KIAA0557

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-28457
Species: Hu
Applications: WB, Flow, IHC, IHC-Fr, IHC-P, IP, ICC
NBP2-56136
Species: Hu
Applications: ICC/IF
NBP1-85978
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-79951
Species: Hu
Applications: WB
H00009098-M01
Species: Hu
Applications: WB, ELISA
H00002027-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP2-20385
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NLS7412
Species: Hu, Mu, Rt, Po, Bt, Bv, Eq, Mk, Pm
Applications: IHC, IHC-P
NBP1-90261
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00003753-M01
Species: Hu
Applications: WB, ELISA, RNAi
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-19344
Species: Hu, Mu, Rt, Bv
Applications: WB, Simple Western, IHC, IHC-P

Publications for ZNF232 Partial Recombinant Protein (H00007775-Q01) (0)

There are no publications for ZNF232 Partial Recombinant Protein (H00007775-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF232 Partial Recombinant Protein (H00007775-Q01) (0)

There are no reviews for ZNF232 Partial Recombinant Protein (H00007775-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF232 Partial Recombinant Protein (H00007775-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZNF232 Products

Bioinformatics Tool for ZNF232 Partial Recombinant Protein (H00007775-Q01)

Discover related pathways, diseases and genes to ZNF232 Partial Recombinant Protein (H00007775-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF232 Partial Recombinant Protein (H00007775-Q01)

Discover more about diseases related to ZNF232 Partial Recombinant Protein (H00007775-Q01).
 

Pathways for ZNF232 Partial Recombinant Protein (H00007775-Q01)

View related products by pathway.

Blogs on ZNF232

There are no specific blogs for ZNF232, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ENO3 Antibody (5D1)
H00002027-M01
ZNF232 Antibody
NBP1-86822

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ZNF232 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF232