Recombinant Human ZNF230 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ZNF230 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-474 of Human ZNF230 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MTTFKEAVTFKDVAVFFTEEELGLLDPAQRKLYQDVMLENFTNLLSVGHQPFHPFHFLREEKFWMMETATQREGNSGGKTIAEAGPHEDCPCQQIWEQTASDLTQSQDSIINNSHFFEQGDVPSQVEAGLSIIHTGQKPSQNGKCKQSFSDVAIFDPPQQFHSGEKSHTCNECGKSFCYISALRIHQRVHLREKLSKCDMRGKEFSQSSCLQTRERVHTGEKPFKCEQCGKGFRCRAILQVHCKLHTGEKPYICEKCGRAFIHDFQLQKHQIIHTGEKPFKCEICGKSFCLRSSLNRHCMVHTAEKLYKSEECGKGFTDSLDLHKHQIIHTGQKPYNCKECGKSFRWSSYLLIHQRIHSGEKPYRCEECGKGYISKSGLNLHQRVHTGERPYNCKECGKSFSRASSILNHKKLHCRKKPFKCEDCGKRLVHRSFCKDQQGDHNGENSSKCEDCGKRYKRRLNLDIILSLFLNDM

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
ZNF230

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ZNF230 Protein

  • FLJ12515
  • FLJ14855
  • zinc finger protein 502

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00050862-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
AF5286
Species: Hu
Applications: WB
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
MAB6799
Species: Hu
Applications: WB, IHC
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
H00007773-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for ZNF230 Recombinant Protein (H00007773-P01) (0)

There are no publications for ZNF230 Recombinant Protein (H00007773-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF230 Recombinant Protein (H00007773-P01) (0)

There are no reviews for ZNF230 Recombinant Protein (H00007773-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF230 Recombinant Protein (H00007773-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZNF230 Products

Bioinformatics Tool for ZNF230 Recombinant Protein (H00007773-P01)

Discover related pathways, diseases and genes to ZNF230 Recombinant Protein (H00007773-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF230 Recombinant Protein (H00007773-P01)

Discover more about diseases related to ZNF230 Recombinant Protein (H00007773-P01).
 

Pathways for ZNF230 Recombinant Protein (H00007773-P01)

View related products by pathway.

Research Areas for ZNF230 Recombinant Protein (H00007773-P01)

Find related products by research area.

Blogs on ZNF230

There are no specific blogs for ZNF230, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SP1 Antibody
NB600-233
ZNF230 Antibody
NBP2-58880
BRD2 Antibody
NBP1-30475

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ZNF230 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF230