Recombinant Human ZNF14 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ZNF14 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 70-161 of Human ZNF14 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:RLCESRRGSKCGETTSQMPNVNINKETFTGAKPHECSFCGRDFIHHSSLNRHMRSHTGQKPNEYQEYEKQPCKCKAVGKTFSYHHCFRKHER

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
ZNF14

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ZNF14 Protein

  • GIOT4
  • GIOT-4gonadotropin inducible transcription repressor-4
  • Gonadotropin-inducible ovary transcription repressor 4
  • KOX6Zinc finger protein KOX6
  • zinc finger protein 14 (KOX 6)
  • zinc finger protein 14

Background

ZNF14 - zinc finger protein 14 (KOX 6)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32382
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84108
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-30794
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-59679
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81758
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13557
Species: Hu
Applications: IHC, IHC-P
NBP1-81347
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00007576-P01
Species: Hu
NBP2-30999
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-49161
Species: Hu
Applications: IHC
NBP2-46835
Species: Hu
Applications: IHC, IHC-P
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NB200-305
Species: Hu, Mu, Mk
Applications: WB, ChIP, DB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-57524
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-13219
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-57516
Species: Hu
Applications: WB
NBP2-43651
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00007561-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for ZNF14 Partial Recombinant Protein (H00007561-Q01) (0)

There are no publications for ZNF14 Partial Recombinant Protein (H00007561-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF14 Partial Recombinant Protein (H00007561-Q01) (0)

There are no reviews for ZNF14 Partial Recombinant Protein (H00007561-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF14 Partial Recombinant Protein (H00007561-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZNF14 Products

Bioinformatics Tool for ZNF14 Partial Recombinant Protein (H00007561-Q01)

Discover related pathways, diseases and genes to ZNF14 Partial Recombinant Protein (H00007561-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF14 Partial Recombinant Protein (H00007561-Q01)

Discover more about diseases related to ZNF14 Partial Recombinant Protein (H00007561-Q01).
 

Pathways for ZNF14 Partial Recombinant Protein (H00007561-Q01)

View related products by pathway.

Blogs on ZNF14

There are no specific blogs for ZNF14, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ZNF14 Antibody
NBP2-13552
REV1 Antibody
NBP2-13219

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ZNF14 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF14