ZFAND2B Antibody


Western Blot: ZFAND2B Antibody [NBP1-89174] - Analysis in human cell line HepG2.
Immunocytochemistry/ Immunofluorescence: ZFAND2B Antibody [NBP1-89174] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus & nucleoli.
Immunohistochemistry-Paraffin: ZFAND2B Antibody [NBP1-89174] - Staining of human kidney shows strong cytoplasmic and nuclear positivity in cells in tubules.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

ZFAND2B Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: CPLCNVPVPVARGEPPDRAVGEHIDRDCRSDPAQQKRKIFTNKCERAGCRQREMMKLTCERCSRNFCIKH
Specificity of human, mouse ZFAND2B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (96%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZFAND2B Protein (NBP1-89174PEP)
Read Publication using
NBP1-89174 in the following applications:

  • 1 publication
  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 26692333). Human reactivity reported in scientific literature (PMID: 26692333).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ZFAND2B Antibody

  • AIRAP-like protein
  • AN1-type 2B
  • AN1-type zinc finger protein 2B
  • arsenite inducible RNA associated protein-like
  • Arsenite-inducible RNA-associated protein-like protein
  • zinc finger, AN1-type domain 2B


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
Species: Hu, Mu
Applications: WB, IHC, ICC
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ZFAND2B Antibody (NBP1-89174)(1)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 2 applications: IHC-P, WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for ZFAND2B Antibody (NBP1-89174) (0)

There are no reviews for ZFAND2B Antibody (NBP1-89174). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ZFAND2B Antibody (NBP1-89174) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ZFAND2B Products

Bioinformatics Tool for ZFAND2B Antibody (NBP1-89174)

Discover related pathways, diseases and genes to ZFAND2B Antibody (NBP1-89174). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZFAND2B Antibody (NBP1-89174)

Discover more about diseases related to ZFAND2B Antibody (NBP1-89174).

PTMs for ZFAND2B Antibody (NBP1-89174)

Learn more about PTMs related to ZFAND2B Antibody (NBP1-89174).

Blogs on ZFAND2B

There are no specific blogs for ZFAND2B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ZFAND2B Antibody and receive a gift card or discount.


Gene Symbol ZFAND2B