ZDHHC16 Antibody

Images

 
Western Blot: ZDHHC16 Antibody [NBP1-89041] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: ZDHHC16 Antibody [NBP1-89041] - Staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZDHHC16 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VLISRGETSIERHINKKERRRLQAKGRVFRNPYNYGCLDNWKVFLGVDTGRHWLTRVLLPSSHLPHGNGMSWEPPPWVTA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZDHHC16
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ZDHHC16 Protein (NBP1-89041PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZDHHC16 Antibody

  • DHHC domain containing 16
  • EC 2.3.1
  • EC 2.3.1.-
  • zinc finger, DHHC-type containing 16

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92510
Species: Hu
Applications: IHC, IHC-P
AF5414
Species: Hu
Applications: WB, Simple Western
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB120-495
Species: Hu, Mu, Rt, Dr
Applications: WB, ICC/IF, IHC, IP
NBP2-16197
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00009446-B01P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
MAB7708
Species: Hu
Applications: WB, ICC
NBP2-13440
Species: Hu
Applications: WB, IHC, IHC-P
H00009527-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-38019
Species: Hu
Applications: IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NB100-56530
Species: Hu
Applications: WB
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1834
Species: Hu
Applications: WB, ICC/IF, Flow-IC

Publications for ZDHHC16 Antibody (NBP1-89041) (0)

There are no publications for ZDHHC16 Antibody (NBP1-89041).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZDHHC16 Antibody (NBP1-89041) (0)

There are no reviews for ZDHHC16 Antibody (NBP1-89041). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZDHHC16 Antibody (NBP1-89041) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZDHHC16 Products

Bioinformatics Tool for ZDHHC16 Antibody (NBP1-89041)

Discover related pathways, diseases and genes to ZDHHC16 Antibody (NBP1-89041). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for ZDHHC16 Antibody (NBP1-89041)

View related products by pathway.

Research Areas for ZDHHC16 Antibody (NBP1-89041)

Find related products by research area.

Blogs on ZDHHC16

There are no specific blogs for ZDHHC16, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZDHHC16 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZDHHC16