ZDHHC16 Antibody

Western Blot: ZDHHC16 Antibody [NBP1-89041] - Analysis using Anti-ZDHHC16 antibody NBP1-89041 (A) shows similar pattern to independent antibody NBP2-55212 (B).

Immunohistochemistry-Paraffin: ZDHHC16 Antibody [NBP1-89041] - Staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.

Product Discontinued

ZDHHC16 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VLISRGETSIERHINKKERRRLQAKGRVFRNPYNYGCLDNWKVFLGVDTGRHWLTRVLLPSSHLPHGNGMSWEPPPWVTA
• Predicted Species: Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZDHHC16
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ZDHHC16 Antibody

• DHHC domain containing 16
• EC 2.3.1
• EC 2.3.1.-
• zinc finger, DHHC-type containing 16

Background

ZDHHC16 may be involved in apoptosis regulation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZDHHC16