Recombinant Human ZDHHC15 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ZDHHC15 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 337 of Human ZDHHC15 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MRRGWKMALSGGLRCCRRVLSWVPVLVIVLVVLWSYYAYVFELCLVTVLSPAEKVIYLILYHAIFVFFTWTYWKSIFTLPQQPNQKFHLSYTDKERYENEERPEVQKQMLVDMAKKLPVYTRTGSGAVRFCDRCHLIKPDRCHHCSVCAMCVLKMDHHCPWVNNCIGFSNYKFFLQFLAYSVLYCLYIATTVFSYFIKYWRGELPSVRSKFHVLFLLFVACMFFVSLVILFGYHCWLVSRNKTTLEAFCTPVFTSGPEKNGFNLGFIKNIQQVFGDKKKFWLIPIGSSPGDGHSFPMRSMNESQNPLLANEETWEDNEDDNQDYPEGSSSLAVETET

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
ZDHHC15

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ZDHHC15 Protein

  • DHHC-15
  • EC 2.3.1
  • EC 2.3.1.-
  • FLJ31812
  • MGC119974
  • MGC119975
  • MRX91MGC119976
  • palmitoyltransferase ZDHHC15
  • Zinc finger DHHC domain-containing protein 15
  • zinc finger, DHHC domain containing 15
  • zinc finger, DHHC-type containing 15

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP1-81418
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83822
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-31763
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00006532-M06
Species: Hu
Applications: ELISA, IP
NBP2-45388
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84499
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF2934
Species: Mu
Applications: WB, Simple Western, IHC, Block
NBP1-81748
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00158866-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for ZDHHC15 Recombinant Protein (H00158866-P01) (0)

There are no publications for ZDHHC15 Recombinant Protein (H00158866-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZDHHC15 Recombinant Protein (H00158866-P01) (0)

There are no reviews for ZDHHC15 Recombinant Protein (H00158866-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZDHHC15 Recombinant Protein (H00158866-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZDHHC15 Products

Bioinformatics Tool for ZDHHC15 Recombinant Protein (H00158866-P01)

Discover related pathways, diseases and genes to ZDHHC15 Recombinant Protein (H00158866-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZDHHC15 Recombinant Protein (H00158866-P01)

Discover more about diseases related to ZDHHC15 Recombinant Protein (H00158866-P01).
 

Pathways for ZDHHC15 Recombinant Protein (H00158866-P01)

View related products by pathway.

PTMs for ZDHHC15 Recombinant Protein (H00158866-P01)

Learn more about PTMs related to ZDHHC15 Recombinant Protein (H00158866-P01).

Blogs on ZDHHC15

There are no specific blogs for ZDHHC15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ZDHHC15 Antibody
NBP1-82014

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ZDHHC15 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ZDHHC15