![Immunocytochemistry/Immunofluorescence: WDR41 Antibody [NBP1-83812] - Staining of human cell line U-2 OS shows localization to nucleus & cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/WDR41-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83812-img0006.jpg "Immunocytochemistry/Immunofluorescence: WDR41 Antibody [NBP1-83812] - Staining of human cell line U-2 OS shows localization to nucleus & cytosol. Antibody staining is shown in green.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit WDR41 Antibody - BSA Free (NBP1-83812) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-WDR41 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KQQLAAEPVPTGFFNMWGFGRVSKQASQPVKKQQENATSCSLELIGDLIGHSSSVEMFLYFEDHGLVTCSADHLIILWKNGERESGLR |
| Predicted Species | Rat (94%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | WDR41 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publications using NBP1-83812 | Applications | Species |
|---|---|---|
| Sellier C, Campanari ML, Julie Corbier C et al. Loss of C9ORF72 impairs autophagy and synergizes with polyQ Ataxin-2 to induce motor neuron dysfunction and cell death. EMBO J. 2016-04-21 [PMID: 27103069] (WB, Human, Mouse) | WB | Human, Mouse |
| Amick J, Tharkeshwar AK, Talaia G et al. PQLC2 signals lysosomal cationic amino acid abundance to the C9orf72 complex bioRxiv |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | WDR41 |
![Immunohistochemistry-Paraffin: WDR41 Antibody [NBP1-83812] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/WDR41-Antibody-Immunohistochemistry-Paraffin-NBP1-83812-img0013.jpg "Immunohistochemistry-Paraffin: WDR41 Antibody [NBP1-83812] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: WDR41 Antibody [NBP1-83812] - Staining of human cerebral cortex shows strong positivity in neuropil.](http://images.novusbio.com/fullsize/WDR41-Antibody-Immunohistochemistry-Paraffin-NBP1-83812-img0011.jpg "Immunohistochemistry-Paraffin: WDR41 Antibody [NBP1-83812] - Staining of human cerebral cortex shows strong positivity in neuropil.")
![Immunohistochemistry-Paraffin: WDR41 Antibody [NBP1-83812] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/WDR41-Antibody-Immunohistochemistry-Paraffin-NBP1-83812-img0012.jpg "Immunohistochemistry-Paraffin: WDR41 Antibody [NBP1-83812] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: WDR41 Antibody [NBP1-83812] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/WDR41-Antibody-Immunohistochemistry-Paraffin-NBP1-83812-img0014.jpg "Immunohistochemistry-Paraffin: WDR41 Antibody [NBP1-83812] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")