WBSCR16 Antibody

Images

 
Immunohistochemistry: WBSCR16 Antibody [NBP2-31833] - Staining of stomach.
Immunohistochemistry: WBSCR16 Antibody [NBP2-31833] - Staining of human stomach, upper shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry: WBSCR16 Antibody [NBP2-31833] - Staining of stomach.
Immunohistochemistry: WBSCR16 Antibody [NBP2-31833] - Staining of liver cancer.
Immunohistochemistry: WBSCR16 Antibody [NBP2-31833] - Staining of human stomach, upper shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry: WBSCR16 Antibody [NBP2-31833] - Staining of liver cancer.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

WBSCR16 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: TLLSSKTADVTKVWGMGLNKDSQLGFHRSRKDKTRGYEYVLEPSPVSLPLDRPQETRVLQVSCGRAHSLVLTDREGVFSMGNNSYGQCGRKVVEN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WBSCR16
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
WBSCR16 Protein (NBP2-31833PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for WBSCR16 Antibody

  • DKFZp434D0421
  • MGC189739
  • MGC44931
  • RCC1-like G exchanging factor-like protein
  • Williams-Beuren syndrome chromosomal region 16 protein
  • Williams-Beuren syndrome chromosome region 16

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89416
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92192
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00084277-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-31454
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-81843
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-33574
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for WBSCR16 Antibody (NBP2-31833) (0)

There are no publications for WBSCR16 Antibody (NBP2-31833).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WBSCR16 Antibody (NBP2-31833) (0)

There are no reviews for WBSCR16 Antibody (NBP2-31833). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for WBSCR16 Antibody (NBP2-31833) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional WBSCR16 Products

Bioinformatics Tool for WBSCR16 Antibody (NBP2-31833)

Discover related pathways, diseases and genes to WBSCR16 Antibody (NBP2-31833). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WBSCR16 Antibody (NBP2-31833)

Discover more about diseases related to WBSCR16 Antibody (NBP2-31833).

Blogs on WBSCR16

There are no specific blogs for WBSCR16, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our WBSCR16 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WBSCR16
Uniprot