VSTM2A Antibody


Western Blot: VSTM2A Antibody [NBP1-81114] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted)
Immunohistochemistry-Paraffin: VSTM2A Antibody [NBP1-81114] - Staining of human kidney shows distinct positivity in cytoplasm and luminal membranes.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

VSTM2A Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: VSAAIPSSIHGSANQRTHSTSSPQVVAKIPKQSPQSGMETHFEPFILPLTNAPQKGQSYRVDRFMNG
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
VSTM2A Protein (NBP1-81114PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for VSTM2A Antibody

  • MGC33530
  • V-set and transmembrane domain containing 2
  • V-set and transmembrane domain containing 2A
  • V-set and transmembrane domain-containing protein 2A
  • VSTM2
  • VSTM2A


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, Flow, IHC
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: WB, IHC
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P

Publications for VSTM2A Antibody (NBP1-81114) (0)

There are no publications for VSTM2A Antibody (NBP1-81114).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VSTM2A Antibody (NBP1-81114) (0)

There are no reviews for VSTM2A Antibody (NBP1-81114). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VSTM2A Antibody (NBP1-81114) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional VSTM2A Products

Bioinformatics Tool for VSTM2A Antibody (NBP1-81114)

Discover related pathways, diseases and genes to VSTM2A Antibody (NBP1-81114). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on VSTM2A

There are no specific blogs for VSTM2A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our VSTM2A Antibody and receive a gift card or discount.


Gene Symbol VSTM2A