VSIG1 Antibody


Western Blot: VSIG1 Antibody [NBP1-81073] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: VSIG1 Antibody [NBP1-81073] - Staining of human cell line PC-3 shows localization to cytosol & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: VSIG1 Antibody [NBP1-81073] - Staining of human stomach shows high expression.
Immunohistochemistry-Paraffin: VSIG1 Antibody [NBP1-81073] - Staining of human stomach shows strong membranous and cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: VSIG1 Antibody [NBP1-81073] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: VSIG1 Antibody [NBP1-81073] - Staining in human stomach and liver tissues using anti-VSIG1 antibody. Corresponding VSIG1 RNA-seq data are presented for the same tissues.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

VSIG1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: KAKAKAKERNSKTIAELEPMTKINPRGESEAMPREDATQLEVTLPSSIHETGPDTIQEPD
Specificity of human VSIG1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
VSIG1 Protein (NBP1-81073PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for VSIG1 Antibody

  • Cell surface A33 antigen
  • dJ889N15.1
  • Glycoprotein A34
  • GPA34
  • MGC44287,1700062D20Rik
  • V-set and immunoglobulin domain containing 1
  • V-set and immunoglobulin domain-containing protein 1
  • VSIG1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu
Applications: WB, IHC, ICC
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IP (-), WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for VSIG1 Antibody (NBP1-81073) (0)

There are no publications for VSIG1 Antibody (NBP1-81073).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VSIG1 Antibody (NBP1-81073) (0)

There are no reviews for VSIG1 Antibody (NBP1-81073). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for VSIG1 Antibody (NBP1-81073) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional VSIG1 Products

Bioinformatics Tool for VSIG1 Antibody (NBP1-81073)

Discover related pathways, diseases and genes to VSIG1 Antibody (NBP1-81073). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VSIG1 Antibody (NBP1-81073)

Discover more about diseases related to VSIG1 Antibody (NBP1-81073).

Pathways for VSIG1 Antibody (NBP1-81073)

View related products by pathway.

PTMs for VSIG1 Antibody (NBP1-81073)

Learn more about PTMs related to VSIG1 Antibody (NBP1-81073).

Blogs on VSIG1

There are no specific blogs for VSIG1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our VSIG1 Antibody and receive a gift card or discount.


Gene Symbol VSIG1