VSIG1 Antibody - BSA Free

Western Blot: VSIG1 Antibody [NBP1-81073] - Analysis in human cell line PC-3.

Immunocytochemistry/Immunofluorescence: VSIG1 Antibody [NBP1-81073] - Staining of human cell line PC-3 shows localization to cytosol & vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: VSIG1 Antibody [NBP1-81073] - Staining in human stomach and liver tissues using anti-VSIG1 antibody. Corresponding VSIG1 RNA-seq data are presented for the same tissues.

Western Blot: VSIG1 Antibody [NBP1-81073] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp

Immunohistochemistry-Paraffin: VSIG1 Antibody [NBP1-81073] - Staining of human stomach shows strong membranous and cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: VSIG1 Antibody [NBP1-81073] - Staining of human liver shows low expression as expected.

Immunohistochemistry-Paraffin: VSIG1 Antibody [NBP1-81073] - Staining of human stomach shows high expression.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

VSIG1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit VSIG1 Antibody - BSA Free (NBP1-81073) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KAKAKAKERNSKTIAELEPMTKINPRGESEAMPREDATQLEVTLPSSIHETGPDTIQEPD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: VSIG1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:10-1:20
  • Western Blot 1:100-1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  VSIG1 Protein (NBP1-81073PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for VSIG1 Antibody - BSA Free

• Cell surface A33 antigen
• dJ889N15.1
• Glycoprotein A34
• GPA34
• MGC44287,1700062D20Rik
• V-set and immunoglobulin domain containing 1
• V-set and immunoglobulin domain-containing protein 1
• VSIG1

Background

The VSIG1 gene encodes a member of the junctional adhesion molecule (JAM) family. The encoded protein contains multipleglycosylation sites at the N-terminal region, and multiple phosphorylation sites and glutamic acid/proline (EP)repeats at the C-terminal regi

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: VSIG1
• Entrez:
  • 340547(Human)
• Uniprot:
  • Q86XK7()
  • Q86XK7()
  • Q86XK7()
  • Q86XK7()