VIP R1/VPAC1 Antibody

Images

 
Western Blot: VIP Receptor 1 Antibody [NBP1-89640] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-626
Immunocytochemistry/ Immunofluorescence: VIP Receptor 1 Antibody [NBP1-89640] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli, plasma membrane and cytoplasm.
Immunohistochemistry-Paraffin: VIP Receptor 1 Antibody [NBP1-89640] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

VIP R1/VPAC1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EECDYVQMIEVQHKQCLEEAQLENETIGCSKMWDNLTCWPATPRGQVVVLACPLIFKLFSSIQGRNVSRSCTDEGWTHLEPGPYPIACGLDDKAASLDEQQTMFYGSVKTGY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VIPR1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. ICC/IF reactivity reported in scientific literature (PMID: 27059672).
Control Peptide
VIP R1/VPAC1 Protein (NBP1-89640PEP)
Publications
Read Publication using
NBP1-89640 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for VIP R1/VPAC1 Antibody

  • FLJ41949
  • HVR1
  • II
  • PACAP type II receptor
  • PACAP-R2
  • RDC1
  • type II
  • V1RG
  • vasoactive intestinal peptide receptor 1
  • vasoactive intestinal polypeptide receptor 1
  • VIP R1
  • VIP receptor, type I
  • VIPR
  • VIPR1
  • VPAC1
  • VPAC1R

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF6380
Species: Mu
Applications: WB
MAB5416
Species: Hu
Applications: IHC
NBP1-31619
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NLS948
Species: Hu, Bt, Ca, Ch, Mk, Pm, Xp
Applications: IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33820
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF3499
Species: Hu
Applications: WB
NBP2-14934
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
NBP2-24779
Species: Hu, Mu, Rt, Bv, Eq, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC-P
NBP1-31293
Species: Hu, Mu
Applications: WB, ICC/IF
MAB172
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
NBP2-48988
Species: Hu
Applications: IHC
NBP1-89640
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for VIP R1/VPAC1 Antibody (NBP1-89640)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ICC/IF, IHC-P.


Filter By Application
ICC/IF
(1)
IHC-P
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for VIP R1/VPAC1 Antibody (NBP1-89640) (0)

There are no reviews for VIP R1/VPAC1 Antibody (NBP1-89640). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for VIP R1/VPAC1 Antibody (NBP1-89640) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional VIP R1/VPAC1 Products

Bioinformatics Tool for VIP R1/VPAC1 Antibody (NBP1-89640)

Discover related pathways, diseases and genes to VIP R1/VPAC1 Antibody (NBP1-89640). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VIP R1/VPAC1 Antibody (NBP1-89640)

Discover more about diseases related to VIP R1/VPAC1 Antibody (NBP1-89640).
 

Pathways for VIP R1/VPAC1 Antibody (NBP1-89640)

View related products by pathway.

PTMs for VIP R1/VPAC1 Antibody (NBP1-89640)

Learn more about PTMs related to VIP R1/VPAC1 Antibody (NBP1-89640).
 

Research Areas for VIP R1/VPAC1 Antibody (NBP1-89640)

Find related products by research area.

Blogs on VIP R1/VPAC1

There are no specific blogs for VIP R1/VPAC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VIP R1/VPAC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol VIPR1
Entrez