USH1C Antibody


Western Blot: USH1C Antibody [NBP1-89191] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: CACO-2
Immunohistochemistry: USH1C Antibody [NBP1-89191] - Staining of human duodenum shows strong membranous positivity in glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

USH1C Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: LVGDLKLVINEPSRLPLFDAIRPLIPLKHQVEYDQLTPRRSRKLKEVRLDRLHPEGLGLSVRGGLEFGCGLFISHLI
Specificity of human USH1C antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
USH1C Protein (NBP1-89191PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for USH1C Antibody

  • AIE75
  • AIE-75
  • Antigen NY-CO-38/NY-CO-37
  • Autoimmune enteropathy-related antigen AIE-75
  • deafness, autosomal recessive 18
  • DFNB18
  • harmonin
  • NY-CO-37
  • NY-CO-38
  • PDZ-45
  • PDZ73
  • PDZ-73
  • PDZ-73/NY-CO-38
  • Protein PDZ-73
  • Renal carcinoma antigen NY-REN-3
  • ush1cpst
  • Usher syndrome 1C (autosomal recessive, severe)
  • Usher syndrome type-1C protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, ICC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Ze
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr
Species: Hu, Eq
Applications: WB, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Rt, Ca, Ha
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for USH1C Antibody (NBP1-89191) (0)

There are no publications for USH1C Antibody (NBP1-89191).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for USH1C Antibody (NBP1-89191) (0)

There are no reviews for USH1C Antibody (NBP1-89191). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for USH1C Antibody (NBP1-89191) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional USH1C Products

Bioinformatics Tool for USH1C Antibody (NBP1-89191)

Discover related pathways, diseases and genes to USH1C Antibody (NBP1-89191). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for USH1C Antibody (NBP1-89191)

Discover more about diseases related to USH1C Antibody (NBP1-89191).

Pathways for USH1C Antibody (NBP1-89191)

View related products by pathway.

Research Areas for USH1C Antibody (NBP1-89191)

Find related products by research area.

Blogs on USH1C.

Auditory Infographic: Can you hear me now?
The auditory process involves several structures of the ear to convert sound waves into information that is processed by our brain. Learn more about the auditory process in our infographic below.Novus Biologicals offers reagents mentioned in the i...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our USH1C Antibody and receive a gift card or discount.


Gene Symbol USH1C