USH1C Antibody - BSA Free

Western Blot: USH1C Antibody [NBP1-89190] - Analysis in human cell lines Caco-2 and PC-3 using anti-USH1C antibody. Corresponding USH1C RNA-seq data are presented for the same cell lines. Loading control: anti-HSP90B1.

Immunocytochemistry/Immunofluorescence: USH1C Antibody [NBP1-89190] - Staining of human cell line CACO-2 shows localization to cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: USH1C Antibody [NBP1-89190] - Staining of human duodenum shows strong membranous and cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

USH1C Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit USH1C Antibody - BSA Free (NBP1-89190) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-USH1C Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: IVEEEEKFKKQWEEDWGSKEQLLLPKTITAEVHPVPLRKPKYDQGVEPELEPADDLDGGTEEQGEQDFRKYEEGFDPYSM
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: USH1C
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  USH1C Protein (NBP1-89190PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (85%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for USH1C Antibody - BSA Free

• AIE75
• AIE-75
• Antigen NY-CO-38/NY-CO-37
• Autoimmune enteropathy-related antigen AIE-75
• deafness, autosomal recessive 18
• DFNB18
• harmonin
• NY-CO-37
• NY-CO-38
• PDZ-45
• PDZ73
• PDZ-73
• PDZ-73/NY-CO-38
• Protein PDZ-73
• Renal carcinoma antigen NY-REN-3
• ush1cpst
• Usher syndrome 1C (autosomal recessive, severe)
• Usher syndrome type-1C protein

Background

USH1C may be involved in protein-protein interaction. Defects in USH1C are the cause of Usher syndrome type 1c. It is an autosomal recessive sensory defect involving congenital profound sensorineural deafness, vestibular dysfunction, and blindness due to progressive retinitis pigmentosa. Defects in USH1C are also the cause of nonsyndromic recessive deafness.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for USH1C Antibody (NBP1-89190)(1)

Publication using NBP1-89190

• McConnell RE, Benesh AE, Mao S et al. Proteomic analysis of the enterocyte brush border. Am J Physiol Gastrointest Liver Physiol 2011-05-01 [PMID: 21330445]

Bioinformatics

• Gene Symbol: USH1C