UNC13C Antibody

Product Discontinued

UNC13C Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VLDELSVTYGESFQVIIEECIKQMSFELNQMRANGNTTSNKNSAAMDAEIV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: UNC13C
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (82%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for UNC13C Antibody

• DKFZp547H074
• Munc13-3
• protein unc-13 homolog C
• unc-13 homolog C (C. elegans)
• unc-13-like 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: UNC13C