UNC13C Antibody

Images

 
Immunohistochemistry: UNC13C Antibody [NBP1-90539] - Staining of human testis shows strong cytoplasmic positivity in cells of seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UNC13C Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VLDELSVTYGESFQVIIEECIKQMSFELNQMRANGNTTSNKNSAAMDAEIV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UNC13C
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
UNC13C Protein (NBP1-90539PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for UNC13C Antibody

  • DKFZp547H074
  • Munc13-3
  • protein unc-13 homolog C
  • unc-13 homolog C (C. elegans)
  • unc-13-like 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB6188
Species: Hu
Applications: IHC
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NB100-41385
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-92335
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
AF7904
Species: Hu, Mu
Applications: WB
NBP2-34075
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4937
Species: Hu
Applications: WB, IHC
NBP2-32009
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005250-B02P
Species: Hu
Applications: WB, ICC/IF

Publications for UNC13C Antibody (NBP1-90539) (0)

There are no publications for UNC13C Antibody (NBP1-90539).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UNC13C Antibody (NBP1-90539) (0)

There are no reviews for UNC13C Antibody (NBP1-90539). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for UNC13C Antibody (NBP1-90539) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UNC13C Products

UNC13C NBP1-90539

Bioinformatics Tool for UNC13C Antibody (NBP1-90539)

Discover related pathways, diseases and genes to UNC13C Antibody (NBP1-90539). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UNC13C Antibody (NBP1-90539)

Discover more about diseases related to UNC13C Antibody (NBP1-90539).
 

Pathways for UNC13C Antibody (NBP1-90539)

View related products by pathway.

Blogs on UNC13C

There are no specific blogs for UNC13C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UNC13C Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UNC13C