UHRF1BP1L Antibody

Images

 
Immunohistochemistry-Paraffin: UHRF1BP1L Antibody [NBP1-81487] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UHRF1BP1L Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SVNAGANLQNYGETSPDAISTNSEGAQENHDDLMSVVVFKITGVNGEIDIRGEDTEICLQVNQVTPDQLGNISLRHYLCNRPVGSDQKAVIHS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UHRF1BP1L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
UHRF1BP1L Protein (NBP1-81487PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for UHRF1BP1L Antibody

  • KIAA0701UHRF1 (ICBP90) binding protein 1-like
  • UHRF1 binding protein 1-like
  • UHRF1-binding protein 1-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-514
Species: Bv, Hu, Mu, Pm, Rt
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-24664
Species: Hu, Mu, Rt
Applications: Flow, WB
7268-CT
Species: Hu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
H00010228-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP2-45041
Species: Hu, Po
Applications: Flow, ICC/IF, IF

Publications for UHRF1BP1L Antibody (NBP1-81487) (0)

There are no publications for UHRF1BP1L Antibody (NBP1-81487).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UHRF1BP1L Antibody (NBP1-81487) (0)

There are no reviews for UHRF1BP1L Antibody (NBP1-81487). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for UHRF1BP1L Antibody (NBP1-81487) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional UHRF1BP1L Products

Bioinformatics Tool for UHRF1BP1L Antibody (NBP1-81487)

Discover related pathways, diseases and genes to UHRF1BP1L Antibody (NBP1-81487). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on UHRF1BP1L

There are no specific blogs for UHRF1BP1L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UHRF1BP1L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UHRF1BP1L