Recombinant Human UGCGL2 Protein (H00055757-P01)

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human UGCGL2 Protein Summary

Description
UGCGL2 (Human) GST-Tagged Recombinant Protein (P01)

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MAPAKATNVVRLLLGSTALWLSQLGSGTVAASKSVTAHLAAKWPETPLLLEASEFMAEESNEKFWQFLETVQELAIYKQTESDYSYYNLILKKAGQFLDNLHINLLKFAFSIRAYSPAIQMFQQIAADEPPPDGCNAFVVIHKKHTCKINEIKKLLKKAASRTRPYLFKGDHKFPTNKENLPVVILYAEMGTRTFSAFHKVLSEKAQNEEILYVLRHYIQKPSSRKMYLSGYGVELAIKSTEYKALDDTQVKTVTNTTVEDETETNEVQGFLFGKLKS
Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Recombinant Protein
Gene
UGGT2

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human UGCGL2 Protein

  • FLJ10873
  • HUGT2
  • MGC117360
  • UDP-Glc:glycoprotein glucosyltransferase 2
  • UDP-glucose ceramide glucosyltransferase-like 1
  • UDP-glucose glycoprotein glucosyltransferase 2

Background

UGCGL2( AAH32302, 1 a.a. - 279 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF6490
Species: Hu
Applications: WB, IHC, ICC
H00054575-Q01
Species: Hu
NBP1-69412
Species: Hu
Applications: WB
H00054600-B01P
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NBP1-33743
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00054659-M02
Species: Hu
Applications: WB, ELISA
NBP1-72063
Species: Rt
Applications: WB, PEP-ELISA
H00007364-M02-100ug
Species: Hu, Rt
Applications: WB, ELISA
H00007366-B01P
Species: Hu
Applications: WB
H00007363-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
H00007365-R01
Species: Hu
NBP1-84494
Species: Hu
Applications: IHC, IHC-P
NBP1-91335
Species: Hu
Applications: WB, ICC/IF, IHC
NBP1-86458
Species: Hu
Applications: IHC, IHC-P
NBP1-77681
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for UGCGL2 Recombinant Protein (H00055757-P01) (0)

There are no publications for UGCGL2 Recombinant Protein (H00055757-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UGCGL2 Recombinant Protein (H00055757-P01) (0)

There are no reviews for UGCGL2 Recombinant Protein (H00055757-P01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UGCGL2 Recombinant Protein (H00055757-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional UGCGL2 Products

Related Products by Gene

Bioinformatics Tool for UGCGL2 Recombinant Protein (H00055757-P01)

Discover related pathways, diseases and genes to UGCGL2 Recombinant Protein (H00055757-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on UGCGL2

There are no specific blogs for UGCGL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

XBP1 Antibody
NBP1-77681
XBP1 Antibody
NBP1-77681
XBP1 Antibody
NBP1-77681
UGCGL2 Antibody
NBP2-20803
UGCGL2 Antibody
NBP2-20803

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human UGCGL2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol UGGT2