Recombinant Human UGCGL2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human UGCGL2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-278 of Human UGCGL2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAPAKATNVVRLLLGSTALWLSQLGSGTVAASKSVTAHLAAKWPETPLLLEASEFMAEESNEKFWQFLETVQELAIYKQTESDYSYYNLILKKAGQFLDNLHINLLKFAFSIRAYSPAIQMFQQIAADEPPPDGCNAFVVIHKKHTCKINEIKKLLKKAASRTRPYLFKGDHKFPTNKENLPVVILYAEMGTRTFSAFHKVLSEKAQNEEILYVLRHYIQKPSSRKMYLSGYGVELAIKSTEYKALDDTQVKTVTNTTVEDETETNEVQGFLFGKLKS

Protein/Peptide Type
Recombinant Protein
Gene
UGGT2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human UGCGL2 Protein

  • FLJ10873
  • HUGT2
  • MGC117360
  • UDP-Glc:glycoprotein glucosyltransferase 2
  • UDP-glucose ceramide glucosyltransferase-like 1
  • UDP-glucose glycoprotein glucosyltransferase 2

Background

UGCGL2( AAH32302, 1 a.a. - 279 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF6490
Species: Hu
Applications: WB, IHC, ICC
NBP2-06724
Species: Hu
NBP1-69412
Species: Hu
Applications: WB
H00054600-B01P
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NBP1-33743
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00054659-M02
Species: Hu
Applications: WB, ELISA
NBP1-72063
Species: Rt
Applications: WB, PEP-ELISA
H00007364-M02-100ug
Species: Hu, Rt
Applications: WB, ELISA
H00007366-B01P
Species: Hu
Applications: WB
H00007363-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-08443
Species: Hu
NBP1-84494
Species: Hu
Applications: IHC, IHC-P
NBP1-91335
Species: Hu
Applications: WB, ICC/IF, IHC
NBP1-86458
Species: Hu
Applications: IHC, IHC-P
NB100-80861
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for UGCGL2 Recombinant Protein (H00055757-P01) (0)

There are no publications for UGCGL2 Recombinant Protein (H00055757-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UGCGL2 Recombinant Protein (H00055757-P01) (0)

There are no reviews for UGCGL2 Recombinant Protein (H00055757-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UGCGL2 Recombinant Protein (H00055757-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional UGCGL2 Products

Bioinformatics Tool for UGCGL2 Recombinant Protein (H00055757-P01)

Discover related pathways, diseases and genes to UGCGL2 Recombinant Protein (H00055757-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on UGCGL2

There are no specific blogs for UGCGL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

XBP1 Antibody
NB100-80861
UGCGL2 Antibody
NBP2-20803

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human UGCGL2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol UGGT2