TWF2 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TWF2. Source: E. coli
Amino Acid Sequence: HQTGIHATEELKEFFAKARAGSVRLIKVVIEDEQLVLGASQEPVGRWDQDYDRAVLPLLDAQQPCYLLYR Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
TWF2 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-47591. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
26 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for TWF2 Recombinant Protein Antigen
Background
TWF2, also known as Twinfilin-2, is a 349 amino acid protein that is 40 kDa, ubiquitously expressed at protein level, involved in motile and morphological processes, inhibits actin polymerization by sequestering G-actin, and regulates motility by capping the barbed ends. It seems to play an important role in clathrin-mediated endocytosis and distribution of endocytic organelles and participates in regulating the mature length of the middle and short rows of stereocilia. Current research is being performed on several diseases and disorders including monkeypox, cowpox, smallpox, vaccinia, meningioma, leukemia, and neuronitis. The TWF2 protein has shown an interaction with ARHGDIA, ACTR3B, CHGB, CAPZA1, and CAPZA2 in positive regulation of lamellipodium assembly, positive regulation of neuron projection development, cell projection organization, negative regulation of actin filament polymerization, and regulation of microvillus length pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Pm
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Publications for TWF2 Protein (NBP2-47591PEP) (0)
There are no publications for TWF2 Protein (NBP2-47591PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TWF2 Protein (NBP2-47591PEP) (0)
There are no reviews for TWF2 Protein (NBP2-47591PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for TWF2 Protein (NBP2-47591PEP) (0)
Additional TWF2 Products
Research Areas for TWF2 Protein (NBP2-47591PEP)
Find related products by research area.
|
Blogs on TWF2