Recombinant Human TULP2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TULP2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 141-250 of Human TULP2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:EVSVENGSVSPPPFKQSPRIRRKGWQAHQRPGTRAEGESDSQDMGDAHKSPNMGPNPGMDGDCVYENLAFQKEEDLEKKREASESTGTNSSAAHNEELSKALKGEGGTDS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
TULP2
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TULP2 Protein

  • Cancer/testis antigen 65
  • CT65cancer testis antigen 65
  • tubby like protein 2
  • Tubby-like protein 2
  • TUBL2tubby-related protein 2

Background

TULP2 - tubby like protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31401
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20758
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01671
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-74457
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-20245
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89785
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88505
Species: Hu
Applications: IHC, IHC-P
H00064396-P01
Species: Hu
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
H00002729-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-40354
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
H00007288-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for TULP2 Partial Recombinant Protein (H00007288-Q01) (0)

There are no publications for TULP2 Partial Recombinant Protein (H00007288-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TULP2 Partial Recombinant Protein (H00007288-Q01) (0)

There are no reviews for TULP2 Partial Recombinant Protein (H00007288-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TULP2 Partial Recombinant Protein (H00007288-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TULP2 Products

Bioinformatics Tool for TULP2 Partial Recombinant Protein (H00007288-Q01)

Discover related pathways, diseases and genes to TULP2 Partial Recombinant Protein (H00007288-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TULP2 Partial Recombinant Protein (H00007288-Q01)

Discover more about diseases related to TULP2 Partial Recombinant Protein (H00007288-Q01).
 

Pathways for TULP2 Partial Recombinant Protein (H00007288-Q01)

View related products by pathway.

Research Areas for TULP2 Partial Recombinant Protein (H00007288-Q01)

Find related products by research area.

Blogs on TULP2.

Can Tubby Make You Tubby?
The TUB gene, which encodes for the protein Tubby, is evolutionarily conserved in human, chimpanzee, dog, cow, mouse, chicken, zebrafish, fruit fly, mosquito, C. elegans, and rice. The gene derives its name from its role in metabolism; mice with a m...  Read full blog post.

Customers Who Bought This Also Bought

TULP2 Antibody (2B5)
H00007288-M03
RUVBL1 Antibody
NBP2-20245

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TULP2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TULP2