![Western Blot: TSNAXIP1 Antibody [H00055815-B01P] - Analysis of TSNAXIP1 expression in transfected 293T cell line by TSNAXIP1 polyclonal antibody. Lane 1: TSNAXIP1 transfected lysate(40.26 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/TSNAXIP1-Antibody-Western-Blot-H00055815-B01P-img0006.jpg "Western Blot: TSNAXIP1 Antibody [H00055815-B01P] - Analysis of TSNAXIP1 expression in transfected 293T cell line by TSNAXIP1 polyclonal antibody. Lane 1: TSNAXIP1 transfected lysate(40.26 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | TSNAXIP1 (AAH50693.1, 1 a.a. - 366 a.a.) full-length human protein. MQLHMSTLKERDQFFSELQEIQRTSTPRPDWTKCKDVVAGGPERWQMLAEGKNSDQLVDVLLEEIGSGLLREKDFFPGLGYGEAIPAFLRFDGLVENKKPSKKDVVNLLKDAWKERLAEEQKETFPDFFFNFLEHRFGPSDAMAWAYTIFENIKIFHSNEVMSQFYAVLMGKRSENVYVTQKETVAQLLKEMTNADSQNEGLLTMEQFNTVLKSTFPLKTEEQIQELMEAGGWHPSSSNADLLNYRSLFMEDEEGQSEPFVQKLWEQYMDEKDEYLQQLKQELGIELHEEVTLPKLRGGLMTIDPSLDKQTVNTYMSQAFQLPESEMPEEGDEKEEAVVEILQTALERLQVIDIRRVGPREPEPAS |
| Specificity | TSNAXIP1 - translin-associated factor X interacting protein 1, |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | TSNAXIP1 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. Has also been used for immunofluorescence and immunohistochemistry (paraffin) |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: TSNAXIP1 Antibody [H00055815-B01P] - Analysis of purified antibody to TSNAXIP1 on HeLa cell. (antibody concentration 10 ug/ml)](http://images.novusbio.com/fullsize/TSNAXIP1-Antibody-Immunocytochemistry-Immunofluorescence-H00055815-B01P-img0004.jpg "Immunocytochemistry/Immunofluorescence: TSNAXIP1 Antibody [H00055815-B01P] - Analysis of purified antibody to TSNAXIP1 on HeLa cell. (antibody concentration 10 ug/ml)")
![Immunohistochemistry-Paraffin: TSNAXIP1 Antibody [H00055815-B01P] - Analysis of purified antibody to TSNAXIP1 on formalin-fixed paraffin-embedded human stomach. (antibody concentration 3 ug/ml)](http://images.novusbio.com/fullsize/TSNAXIP1-Antibody-Immunohistochemistry-Paraffin-H00055815-B01P-img0005.jpg "Immunohistochemistry-Paraffin: TSNAXIP1 Antibody [H00055815-B01P] - Analysis of purified antibody to TSNAXIP1 on formalin-fixed paraffin-embedded human stomach. (antibody concentration 3 ug/ml)")
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")