TSG-9 Antibody

Images

 
Western Blot: TSG-9 Antibody [NBP1-70738] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TSG-9 Antibody Summary

Immunogen
Synthetic peptides corresponding to TUSC1(tumor suppressor candidate 1) The peptide sequence was selected from the middle region of TUSC1. Peptide sequence DSGREDEPGSPRALRARLEKLEAMYRRALLQLHLEQRGPRPSGDKEEQPL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TUSC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against TUSC1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TSG-9 Antibody

  • TSG9
  • tumor suppressor candidate 1

Background

Tusc1 gene is located within the region of chromosome 9p that harbors tumor suppressor genes critical in carcinogenesis. It is an intronless gene which is downregulated in non-small-cell lung cancer and small-cell lung cancer cell lines, suggesting that it may play a role in lung tumorigenesis.This gene is located within the region of chromosome 9p that harbors tumor suppressor genes critical in carcinogenesis. It is an intronless gene which is downregulated in non-small-cell lung cancer and small-cell lung cancer cell lines, suggesting that it may play a role in lung tumorigenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP1-87677
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57200
Species: Hu
Applications: ICC/IF
H00004507-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for TSG-9 Antibody (NBP1-70738) (0)

There are no publications for TSG-9 Antibody (NBP1-70738).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TSG-9 Antibody (NBP1-70738) (0)

There are no reviews for TSG-9 Antibody (NBP1-70738). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TSG-9 Antibody (NBP1-70738) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TSG-9 Products

Bioinformatics Tool for TSG-9 Antibody (NBP1-70738)

Discover related pathways, diseases and genes to TSG-9 Antibody (NBP1-70738). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TSG-9 Antibody (NBP1-70738)

Discover more about diseases related to TSG-9 Antibody (NBP1-70738).
 

Pathways for TSG-9 Antibody (NBP1-70738)

View related products by pathway.

Blogs on TSG-9

There are no specific blogs for TSG-9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TSG-9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TUSC1