TRMT12 Antibody


Western Blot: TRMT12 Antibody [NBP2-88484] - Host: Rabbit. Target Name: TRMT12. Sample Tissue: Human COLO205 Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

TRMT12 Antibody Summary

The immunogen is a synthetic peptide directed towards the middle region of human TRMT12. Peptide sequence: KEHWLYPQQITTNQWKNGATRDSRGKMLSPATKPEWQRWAESAETRIATL The peptide sequence for this immunogen was taken from within the described region.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified

Alternate Names for TRMT12 Antibody

  • Alpha-amino-alpha-carboxypropyl transferase TYW2
  • EC 2.1.1
  • EC
  • EC 2.5.1.-
  • FLJ20772
  • homolog of yeast tRNA methyltransferase
  • Trm12
  • tRNA methyltranferase 12 homolog (S. cerevisiae)
  • tRNA methyltranferase 12 homolog
  • tRNA methyltransferase 12 homolog (S. cerevisiae)
  • tRNA-yW synthesizing protein 2
  • tRNA-yW-synthesizing protein 2
  • TYW2tRNA wybutosine-synthesizing protein 2 homolog


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for TRMT12 Antibody (NBP2-88484) (0)

There are no publications for TRMT12 Antibody (NBP2-88484).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRMT12 Antibody (NBP2-88484) (0)

There are no reviews for TRMT12 Antibody (NBP2-88484). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRMT12 Antibody (NBP2-88484) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional TRMT12 Products

Bioinformatics Tool for TRMT12 Antibody (NBP2-88484)

Discover related pathways, diseases and genes to TRMT12 Antibody (NBP2-88484). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRMT12 Antibody (NBP2-88484)

Discover more about diseases related to TRMT12 Antibody (NBP2-88484).

Pathways for TRMT12 Antibody (NBP2-88484)

View related products by pathway.

Blogs on TRMT12

There are no specific blogs for TRMT12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TRMT12 Antibody and receive a gift card or discount.


Gene Symbol TRMT12