TRIM34 Antibody - BSA Free

Western Blot: TRIM34 Antibody [NBP1-80359] - Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.

Western Blot: TRIM34 Antibody [NBP1-80359] - Human Thymus lysate, concentration 0.2-1 ug/ml.

Western Blot: TRIM34 Antibody [NBP1-80359] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.

Western Blot: TRIM34 Antibody [NBP1-80359] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

TRIM34 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the N terminal of human TRIM34. Peptide sequence CRACITVSNKEAVTSMGGKSSCPVCGISYSFEHLQANQHLANIVERLKEV. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TRIM34
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for TRIM34 Antibody - BSA Free

• EC 6.3.2
• Interferon-responsive finger protein 1
• interferon-responsive
• RING finger protein 21
• RNF21tripartite motif-containing protein 34
• tripartite motif containing 34
• tripartite motif-containing 34

Background

The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. Expression of this gene is up-regulated by interferon. This gene is mappped to chromosome 11p15, where it resides within a TRIM gene cluster. Alternate splicing of this gene generates four transcript variants. Additionally, a read-through transcript transcribed from this gene and TRIM6 has been observed.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TRIM34
• Uniprot:
  • NP_569074(Human)